DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9592 and Ccdc115

DIOPT Version :9

Sequence 1:NP_648706.2 Gene:CG9592 / 39585 FlyBaseID:FBgn0036426 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_081435.1 Gene:Ccdc115 / 69668 MGIID:1916918 Length:180 Species:Mus musculus


Alignment Length:176 Identity:39/176 - (22%)
Similarity:63/176 - (35%) Gaps:57/176 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IQLIEDLELLHSQVNKESCRAQ---LVLARVRLHQG----------------------------- 34
            :||:.|||.|.::....:.|.:   |.||:.|...|                             
Mouse    15 LQLLSDLEELEAKRAALNARVEEGWLSLAKARYAMGAKSVGPLQYASRMEPQVCVRASEAQDGPQ 79

  Fly    35 -FERIPAEAQLPRG--------RPYKALTRVVENDNYWGKVFKMIRLPVNPILGYLLPVRNIFGC 90
             |..|.|:||.|..        |..|..|:..|    .|...    :|.:|:        |.||.
Mouse    80 TFRVIKADAQTPEEVGPSEASLRRRKGPTKTKE----LGSAV----VPQDPL--------NWFGI 128

  Fly    91 LVSDNLRIANRHWDNCLDLVVECANVQRKLQSTINSIENLRNLLNQ 136
            ||..:||.|...:.:.|.|..:.|::|.::....:.:..|:..|.:
Mouse   129 LVPHSLRQAQASFRDGLQLAADIASLQTRINWGQSQLRGLQKKLKE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9592NP_648706.2 None
Ccdc115NP_081435.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..113 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005685
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31996
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
33.060

Return to query results.
Submit another query.