DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9592 and vma22

DIOPT Version :10

Sequence 1:NP_648706.2 Gene:CG9592 / 39585 FlyBaseID:FBgn0036426 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001013313.1 Gene:vma22 / 503608 ZFINID:ZDB-GENE-050227-20 Length:206 Species:Danio rerio


Alignment Length:65 Identity:20/65 - (30%)
Similarity:32/65 - (49%) Gaps:6/65 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 FGCLVSDNLRIANRHWDNCLDLVVECANVQRKLQSTINSIENLRNLLNQRQCPQMSNDKLKVILK 152
            ||.||..||:.|...:...:.|.||.|:    |||||  :...:.:..|.:..|...:|.::.:|
Zfish   146 FGILVPQNLKQAQSAFKEVITLSVEIAS----LQSTI--LATRKEMQVQMKEKQERTEKAQLEVK 204

  Fly   153  152
            Zfish   205  204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9592NP_648706.2 None
vma22NP_001013313.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..140
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.