DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9592 and CG14671

DIOPT Version :9

Sequence 1:NP_648706.2 Gene:CG9592 / 39585 FlyBaseID:FBgn0036426 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001262288.1 Gene:CG14671 / 40671 FlyBaseID:FBgn0037340 Length:155 Species:Drosophila melanogaster


Alignment Length:142 Identity:46/142 - (32%)
Similarity:74/142 - (52%) Gaps:18/142 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QLIEDLEL-------LHSQ--VNKESCRAQ--LVLARVRLHQGFERIPAEAQLP--RGRPYKALT 54
            ||::||.|       .|:|  :|.|.|.|.  ::|||.|...|..:..:.||:|  ....:.||.
  Fly    13 QLLDDLYLDMFHLVEEHTQCRINLERCNASGAILLARTRFQHGGSQCVSTAQIPTENSAEFNALC 77

  Fly    55 RVVENDNYWGKVFKMIRLPVNPILGYLLPVRNIFGCLVSDNLRIANRHWDNCLDLVVECANVQRK 119
            |||::.:  |...:  |..|:...|::.|: :.|..|...:||.|...:.:|::||.|..|:||:
  Fly    78 RVVDSTD--GVCIE--RQAVDKSKGFVEPL-HWFSVLPPMSLRNAVNKFKDCIELVAESTNLQRQ 137

  Fly   120 LQSTINSIENLR 131
            |...::||..||
  Fly   138 LGEALDSITKLR 149



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005685
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31996
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.