Sequence 1: | NP_648706.2 | Gene: | CG9592 / 39585 | FlyBaseID: | FBgn0036426 | Length: | 152 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262288.1 | Gene: | CG14671 / 40671 | FlyBaseID: | FBgn0037340 | Length: | 155 | Species: | Drosophila melanogaster |
Alignment Length: | 142 | Identity: | 46/142 - (32%) |
---|---|---|---|
Similarity: | 74/142 - (52%) | Gaps: | 18/142 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 QLIEDLEL-------LHSQ--VNKESCRAQ--LVLARVRLHQGFERIPAEAQLP--RGRPYKALT 54
Fly 55 RVVENDNYWGKVFKMIRLPVNPILGYLLPVRNIFGCLVSDNLRIANRHWDNCLDLVVECANVQRK 119
Fly 120 LQSTINSIENLR 131 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0005685 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR31996 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.010 |