DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbg and GOPC

DIOPT Version :9

Sequence 1:NP_001246755.1 Gene:bbg / 39583 FlyBaseID:FBgn0087007 Length:2637 Species:Drosophila melanogaster
Sequence 2:NP_065132.1 Gene:GOPC / 57120 HGNCID:17643 Length:462 Species:Homo sapiens


Alignment Length:498 Identity:101/498 - (20%)
Similarity:192/498 - (38%) Gaps:141/498 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  2053 SGSSAGSQASCSSLGSTPAVDLTR--RVLKSQ---------VINGEA------VALSSRKSILAS 2100
            :|...|. ||| |:|:...|.:.|  .||:.:         ::.||.      :....|:.:.:.
Human    11 AGGGPGG-ASC-SVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSL 73

  Fly  2101 AKCRSA---KSRGQEEDNDSTDGEACSLANRRMKPISSYKLQQQQIQLGKQLVVDKLINV-AAYV 2161
            :.|.:.   |::...:.|...:.:...|.:...      :.|.:::.|.|: |.|:|:.: :..:
Human    74 SSCFAQLCHKAQSVSQINHKLEAQLVDLKSELT------ETQAEKVVLEKE-VHDQLLQLHSIQL 131

  Fly  2162 ELTSDTDDSSRRSDTPAKISAMFIDE-ERKASFKGDPNQQAKVKVEQVKPMVLPMLLPSAKREPL 2225
            :|.:.|..|:......||:|...::| ||:.    :.|::.|:|..|::..|   .|...:.|.|
Human   132 QLHAKTGQSADSGTIKAKLSGPSVEELEREL----EANKKEKMKEAQLEAEV---KLLRKENEAL 189

  Fly  2226 KQQTT--------AELREKF-ERSAAAQAQT----------QNHSPVIHKVTQKPHHERFSSLDS 2271
            ::...        |.|..|: ::..|.:.|.          ..|..:.:::..:.|..|..::..
Human   190 RRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIR 254

  Fly  2272 LASSSSGVSSTTQNVSTTQETATEFGSFSSLGSNQ-SLITAQDVQQIVEEADPPLKTPEAFIIVL 2335
            .....:.:....|               :..|.:| ||..:|.|..|.:             ::|
Human   255 ACRGRNDLKRPMQ---------------APPGHDQDSLKKSQGVGPIRK-------------VLL 291

  Fly  2336 QRENPESSIGITLAGGSDYEAKEITIHKILSNTPAAKDGRLKKGDRILAVNGMSMRGLTHRESIS 2400
            .:|:.| .:||::.||.:: ...|.|.:|....||.:.|.|..||.||||||:::|...|:|:::
Human   292 LKEDHE-GLGISITGGKEH-GVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVT 354

  Fly  2401 VLKTPRPEVVLVV-------------------------------------------TRSESLVVK 2422
            :|...|.|:...|                                           |..|..|::
Human   355 ILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQ 419

  Fly  2423 ALTKK-------RSSLGSLSS--LNEKPTELDYERKRNYHKAS 2456
            ...||       ...||:.|.  |::..::|| :....|||.|
Human   420 GFNKKAVTDTHENGDLGTASETPLDDGASKLD-DLHTLYHKKS 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbgNP_001246755.1 PDZ_signaling 90..177 CDD:238492
ATP-synt_B <1084..>1109 CDD:304375
PDZ_signaling 2331..2413 CDD:238492 28/81 (35%)
PDZ_signaling 2553..2634 CDD:238492
GOPCNP_065132.1 bZIP_2 <166..199 CDD:285017 7/35 (20%)
PDZ_signaling 286..368 CDD:238492 29/96 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 426..449 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.