DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbg and stxbp4

DIOPT Version :9

Sequence 1:NP_001246755.1 Gene:bbg / 39583 FlyBaseID:FBgn0087007 Length:2637 Species:Drosophila melanogaster
Sequence 2:XP_009305072.1 Gene:stxbp4 / 567916 ZFINID:ZDB-GENE-110420-5 Length:749 Species:Danio rerio


Alignment Length:306 Identity:74/306 - (24%)
Similarity:130/306 - (42%) Gaps:72/306 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  2341 ESSIGITLAGGSDYEAKE---ITIHKILSNTPAAKDGRLKKGDRILAVNGMSMRGLTHRESISVL 2402
            :..:|:.:.||...::.|   |.|.:||....||:||||:.||.||.||.|::||:|:.:::.||
Zfish    42 KKGLGVKIIGGYRGQSGEEFGIFIKRILPGGVAAQDGRLRPGDLILDVNNMNLRGVTNEKAVEVL 106

  Fly  2403 K--TPRPEVVLVVTRSESLVVKALTKKRSSLGSLSSLNE-KPTELDYERKRNYHKASRSLDLDLD 2464
            :  :....:.|:|.|.:: ..:..|:.....||.||.:. ..|.:...:..:...:|.|......
Zfish   107 RMASATNHMSLLVVRDDA-SRREFTELMEKYGSSSSTSSGSDTSVSTGKMTDTASSSSSSRSTSP 170

  Fly  2465 LVSNEAGESPVATTPSTGSVSPPQPASLHDEDAEATIAGIRARRQLSRGDAAKLSTSELLERAAE 2529
            |:.:....|||.||....|.||                              ::.|..:::....
Zfish   171 LLLSPKEPSPVYTTACINSPSP------------------------------QVCTDCMIQLICV 205

  Fly  2530 ARNAIAAEIRAQAEDAAASGGGARCVEIVKDSCGLGFSIEGGFDSPLGNRPLI-VKKVFMGGAAQ 2593
            |:..                             |||..|.||.:...|  |:: |:::..||..|
Zfish   206 AKGT-----------------------------GLGLVIRGGANRAEG--PMVFVQEIIQGGDCQ 239

  Fly  2594 KTNQVRNGDEILSINGASTSRMTRVDAWNYMKQLPLGP---VKICF 2636
            |..::::||:::|||..|...:|..:|.:.:.:..|.|   |:|.|
Zfish   240 KDGRLKSGDQLISINKESLVGVTHEEAKSILTRTKLRPDPTVEIAF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbgNP_001246755.1 PDZ_signaling 90..177 CDD:238492
ATP-synt_B <1084..>1109 CDD:304375
PDZ_signaling 2331..2413 CDD:238492 27/76 (36%)
PDZ_signaling 2553..2634 CDD:238492 24/84 (29%)
stxbp4XP_009305072.1 PDZ_signaling 40..120 CDD:238492 27/77 (35%)
PDZ_signaling 207..274 CDD:238492 21/97 (22%)
RILP-like 486..585 CDD:304877
WW 695..724 CDD:278809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.