DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbg and Pdzd3

DIOPT Version :9

Sequence 1:NP_001246755.1 Gene:bbg / 39583 FlyBaseID:FBgn0087007 Length:2637 Species:Drosophila melanogaster
Sequence 2:NP_001178925.1 Gene:Pdzd3 / 500986 RGDID:1559807 Length:498 Species:Rattus norvegicus


Alignment Length:360 Identity:75/360 - (20%)
Similarity:114/360 - (31%) Gaps:152/360 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly  2308 LITAQDVQQIVEEADPPL--------------------KTPEAFIIVLQRE-NPESSIGITLAGG 2351
            |:...:|::...:...||                    |.|:.|..:|:.| .|:..:|..|   
  Rat   230 LVAGPEVEEQCHQLGMPLAAPLAEGWALPAKPRCLNIEKGPQGFGFLLREEKGPDGRLGQFL--- 291

  Fly  2352 SDYEAKEITIHKILSNTPAAKDGRLKKGDRILAVNGMSMRGLTHRESISVLKTPRPEVVLVVTRS 2416
                      .::....||.|.| :|.|||::||.|.||.||.|.|::|.::.....|.|||...
  Rat   292 ----------WEVDPGLPADKAG-MKAGDRLVAVAGESMDGLGHEETVSRIRAQGSCVSLVVVDP 345

  Fly  2417 ESLVVKALTKKRSSLGSLSSLNEKPTELDYERKRNYHKASRSLDLDLDLVSNEAGESPVATT--- 2478
            |:       .:..|:..||.|                         |.|.:.|...:|:|.|   
  Rat   346 EA-------DRFFSMVRLSPL-------------------------LFLENTEIAAAPLAETKDL 378

  Fly  2479 PSTGSVSPPQPASLHDEDAEATIAGIRARRQ--LSRGDAAKLSTSELLERAAEARNAIAAEIRAQ 2541
            |...:|.|               :|:...||  |..|                            
  Rat   379 PVEDTVEP---------------SGLAGSRQCFLYPG---------------------------- 400

  Fly  2542 AEDAAASGGG----ARCVEIVKDSCGLGFSIEGGFDSPLGNRPLIVKKVFMGGAAQKTNQVRNGD 2602
                  .|||    .|||  ....|                  |.:.:|..||:|.:.. ::.||
  Rat   401 ------PGGGYGFRLRCV--ASGPC------------------LFISQVTPGGSAARAG-LQMGD 438

  Fly  2603 EILSINGASTSRMTRVDAWNYMKQ------LPLGP 2631
            .||.:||......:.:|....:.:      |.|.|
  Rat   439 AILEVNGCPVGGDSDLDTLQQLAEAEPPLRLKLAP 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbgNP_001246755.1 PDZ_signaling 90..177 CDD:238492
ATP-synt_B <1084..>1109 CDD:304375
PDZ_signaling 2331..2413 CDD:238492 26/82 (32%)
PDZ_signaling 2553..2634 CDD:238492 19/85 (22%)
Pdzd3NP_001178925.1 PDZ_signaling 47..127 CDD:238492
PDZ_signaling 155..232 CDD:238492 1/1 (100%)
PDZ 260..345 CDD:214570 30/98 (31%)
PDZ_signaling 407..472 CDD:238492 17/85 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.