DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbg and CG6688

DIOPT Version :9

Sequence 1:NP_001246755.1 Gene:bbg / 39583 FlyBaseID:FBgn0087007 Length:2637 Species:Drosophila melanogaster
Sequence 2:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster


Alignment Length:232 Identity:63/232 - (27%)
Similarity:87/232 - (37%) Gaps:64/232 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 TPTNELKESPISATKIPKAKFSRAKTEGEIKLHLPAPKQQSPQSKSRIPIVSTP---TAQKTVPK 466
            ||...|....|..| |..| |...::|.:::..|.|...:        |:|...   |.|.|..|
  Fly   183 TPRRALLAEQIFLT-IANA-FEMCRSENKLRQKLFAGITR--------PVVGRQDRITGQDTWRK 237

  Fly   467 --PVSPT-------MNGTPLS------SNIPRLLQKQKSETDLKLNLYRSKSKESSPRPPLQRAN 516
              ||.||       :.|...|      ||...||  :.:.||:        :.:||..|......
  Fly   238 RRPVLPTNKFLTKLLEGCAYSTDNLSPSNAATLL--RTNTTDV--------AGDSSEIPARTSPV 292

  Fly   517 SAEAPERTFIPVLLNGN----SKSSNSLESV----------SSIGSSSSGNSVRSPKGPKPKPP- 566
            :|..||||.:...|:.|    |.|:|.|:..          ...|::||..|..|..|| |.|. 
  Fly   293 TATPPERTTMHATLDANAAHPSLSTNDLQQEGVKPNAEGVDEESGTNSSHISATSLHGP-PLPAS 356

  Fly   567 -----ERVQSLQKTQIPKLQALPTTPPQQIPKLSMQT 598
                 .....||..:||     |.||.|.:|:..:||
  Fly   357 VSPGINESSGLQPVRIP-----PVTPSQDLPQQVVQT 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbgNP_001246755.1 PDZ_signaling 90..177 CDD:238492
ATP-synt_B <1084..>1109 CDD:304375
PDZ_signaling 2331..2413 CDD:238492
PDZ_signaling 2553..2634 CDD:238492
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.