DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbg and pdzd11

DIOPT Version :9

Sequence 1:NP_001246755.1 Gene:bbg / 39583 FlyBaseID:FBgn0087007 Length:2637 Species:Drosophila melanogaster
Sequence 2:NP_998122.1 Gene:pdzd11 / 405893 ZFINID:ZDB-GENE-040426-2544 Length:142 Species:Danio rerio


Alignment Length:115 Identity:30/115 - (26%)
Similarity:58/115 - (50%) Gaps:30/115 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  2323 PPLKTPEAFI----------------------IVLQRENPESSIGITLAGGSDYEAKE--ITIHK 2363
            |..:.|.|:|                      |||::. |.:.:|..:.||   :|.:  |.|.|
Zfish    18 PSYENPPAWIPPQERIHHPDYNNELAQFLPRTIVLKKP-PGAQLGFNIRGG---KASQLGIFISK 78

  Fly  2364 ILSNTPAAKDGRLKKGDRILAVNGMSMRGLTHRESISVLKTPRPEVVLVV 2413
            ::.::.|.:.| |::||::|:||.:..:.:.|..::.:|||.| |:::.|
Zfish    79 VVPDSDAHRAG-LQEGDQVLSVNEVDFQDIEHSRAVEILKTAR-EILMKV 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbgNP_001246755.1 PDZ_signaling 90..177 CDD:238492
ATP-synt_B <1084..>1109 CDD:304375
PDZ_signaling 2331..2413 CDD:238492 26/105 (25%)
PDZ_signaling 2553..2634 CDD:238492
pdzd11NP_998122.1 PDZ_signaling 47..127 CDD:238492 26/86 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.