DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbg and Zasp66

DIOPT Version :9

Sequence 1:NP_001246755.1 Gene:bbg / 39583 FlyBaseID:FBgn0087007 Length:2637 Species:Drosophila melanogaster
Sequence 2:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster


Alignment Length:506 Identity:100/506 - (19%)
Similarity:148/506 - (29%) Gaps:200/506 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 STSWGNLREGDEIVSIDGRDVRELTRIDC---VRGLKDNVAIKLVVRN----GHGQKPPSEEDPQ 191
            |.:.|.|..||.|..|...|.|:|:..|.   .||..:.  |:|||..    .:.|....|..|.
  Fly    72 SPAHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNE--IRLVVHRDNKIAYTQGATQEAGPG 134

  Fly   192 QQEHLSITLNAQPPPPPPVPPRKLVRRQNSKENQAQLLIEKPLTPPPDAEYYLNLLTESIKAGSE 256
            .:.:.::         |||.|..:..|..|           |..|.|.                 
  Fly   135 SRSNSTL---------PPVTPDLMPHRGPS-----------PFLPGPS----------------- 162

  Fly   257 SDDTASTISTVIDKFSVGSNYSSDSSLNGHELAKVLQ-PFTLLEQEFLPLEQPLGHPKLLIPGNN 320
                                          ...:.|| |...|.|...|         .|.....
  Fly   163 ------------------------------HFERALQLPVDTLPQTVFP---------QLNSSGG 188

  Fly   321 YENVEFKTEKVNVYENVELRSPETTPTPKP-RVQLATVEPKKRSIIPMPRKIPTPTKLPIEVTPP 384
            ||                  .|.|..:||| |.....|:.::.:|:..|.: .||..||      
  Fly   189 YE------------------VPSTVFSPKPTRDHQQDVDEEQAAIVNQPYR-TTPLVLP------ 228

  Fly   385 RVPILEEPKTPTNNKVDSPKT-------PTNELKESP------------ISATKIPKAKFSRAKT 430
                      ....|.|:|.|       |...::..|            ::.|.:.|...|.|.|
  Fly   229 ----------GAKVKKDAPTTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADT 283

  Fly   431 EGEIKLHLPAPKQQSPQSKSRIPIVST----PTAQKTVPKPVSPT--MNGTPLSSNIPRLLQKQK 489
             |.: .|        .|..|.|.:.|.    .|.:.|||...|.:  :..:||...:|       
  Fly   284 -GRV-FH--------KQFNSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLP------- 331

  Fly   490 SETDLKLNLYRSKSKESSPRPPLQRANSAEAPERTFIPVLLNGNSKSSNSLE---SVSSIGSSSS 551
                .|||.|: |:.:..||                       ||::..:::   ..|:.|.||.
  Fly   332 ----TKLNGYK-KTVQYDPR-----------------------NSETYRAIQEEGGYSNYGQSSP 368

  Fly   552 GNSVRSPKGPKPKPPERVQSLQKTQIPKLQALPTTPPQQIPKLSMQTFKQS 602
             ..|..|...|...|.|:...:|    .:.|..:.||..:.....:..:||
  Fly   369 -QEVTIPVQTKVYQPNRLVPGKK----PVSAPVSRPPYNVVNTHDENIRQS 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbgNP_001246755.1 PDZ_signaling 90..177 CDD:238492 16/45 (36%)
ATP-synt_B <1084..>1109 CDD:304375
PDZ_signaling 2331..2413 CDD:238492
PDZ_signaling 2553..2634 CDD:238492
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 15/44 (34%)
DUF4749 285..359 CDD:292558 22/117 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.