DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbg and Whrn

DIOPT Version :9

Sequence 1:NP_001246755.1 Gene:bbg / 39583 FlyBaseID:FBgn0087007 Length:2637 Species:Drosophila melanogaster
Sequence 2:XP_038965801.1 Gene:Whrn / 313255 RGDID:631330 Length:969 Species:Rattus norvegicus


Alignment Length:341 Identity:72/341 - (21%)
Similarity:121/341 - (35%) Gaps:115/341 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  2304 SNQSLITAQDVQQIVEEADPPLKTP-----------EAFIIVLQRENPESSIGITLAGGSDYEAK 2357
            |:|.|......:.:...|..|.:.|           |..::.|:|......:|.::.|||:: ..
  Rat   102 SDQLLFDQYTAEGLYLPATTPYRQPAWAAPDGAGPGEVRLVSLRRAKAHEGLGFSIRGGSEH-GV 165

  Fly  2358 EITIHKILSNTPAAKDGRLKKGDRILAVNGMSMRGLTHRESISVLKTPRPEVVLVVTRSESLVVK 2422
            .|.:..:...:.|.|:| |:.||:||.||..|:..:||.|::..||           .|:.||:.
  Rat   166 GIYVSLVEPGSLAEKEG-LRVGDQILRVNDKSLARVTHAEAVKALK-----------GSKKLVLS 218

  Fly  2423 ALTKKRSSLGSLSSLNEKPTELDYERKRNYHKASRSLDLDLDLVSNEAGESPVATTPSTGSVSPP 2487
            ..:..|...|.::  |...|.:|                                 |...|.|| 
  Rat   219 VYSAGRIPGGYVT--NHIYTWVD---------------------------------PQGRSTSP- 247

  Fly  2488 QPASL--------HDEDAEATIAGIRARRQLSRGDAAKLSTSELLERAAEARNAIAAEIRAQAED 2544
             |:||        |::|..:      |...|..||..|::.                        
  Rat   248 -PSSLPHGSTLRQHEDDRRS------ALHLLQSGDEKKVNL------------------------ 281

  Fly  2545 AAASGGGARCVEIVKDSCGLGFSIEGGFDSPLGNRPLIVKKVFMGGAAQKTNQVRNGDEILSING 2609
                        ::.|...||.:|.||.:..||   :.:..|..|..|:.:. ::.||:||.:||
  Rat   282 ------------VLGDGRSLGLTIRGGAEYGLG---IYITGVDPGSEAESSG-LKVGDQILEVNG 330

  Fly  2610 ASTSRMTRVDAWNYMK 2625
            .|...:...:|...:|
  Rat   331 RSFLSILHDEAVKLLK 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbgNP_001246755.1 PDZ_signaling 90..177 CDD:238492
ATP-synt_B <1084..>1109 CDD:304375
PDZ_signaling 2331..2413 CDD:238492 23/81 (28%)
PDZ_signaling 2553..2634 CDD:238492 20/73 (27%)
WhrnXP_038965801.1 HN_L-whirlin_R1_like 38..113 CDD:259822 3/10 (30%)
PDZ_signaling 139..216 CDD:238492 24/89 (27%)
PDZ_signaling 276..356 CDD:238492 21/111 (19%)
HN_L-whirlin_R2_like 418..498 CDD:259823
PDZ_signaling <908..949 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.