DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbg and Cytip

DIOPT Version :9

Sequence 1:NP_001246755.1 Gene:bbg / 39583 FlyBaseID:FBgn0087007 Length:2637 Species:Drosophila melanogaster
Sequence 2:NP_001012086.1 Gene:Cytip / 311047 RGDID:1307990 Length:359 Species:Rattus norvegicus


Alignment Length:281 Identity:66/281 - (23%)
Similarity:107/281 - (38%) Gaps:83/281 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  2293 ATEFGSFSSLGSNQSLITAQDVQQIVEEADPPLKTPEAFIIVLQRENPESSIGITLAGGSDYEAK 2357
            ::..|.||.  |.:.::|       ||:.|......|.....||.:|..||...|:         
  Rat    64 SSSLGDFSC--SQRKVVT-------VEKQDNGTFGFEIQTYRLQNQNICSSEVCTM--------- 110

  Fly  2358 EITIHKILSNTPAAKDGRLKKGDRILAVNGMSMRGLTHRESISVLKTPRPEVVL------VVTRS 2416
               |.|:..::||...| |:.||....|||:|..|.||::.:.::::....:.:      ::.|.
  Rat   111 ---ICKVQEDSPAHCAG-LQVGDIFANVNGVSTEGFTHKQVVDLIRSSGNLLTIETLNGTMIHRR 171

  Fly  2417 ESLVVKALTKKRSSLGSLSSLNEKPTELDYERKRNYHKASRSLDL-DLDLVSNEAGESP------ 2474
            ..|..|..|.|:       :|.:|..||            |||.| :..|:..:|..||      
  Rat   172 AELEAKLQTLKQ-------TLKKKWVEL------------RSLHLQEQRLLHGDAANSPNLENMN 217

  Fly  2475 VATTPSTGSVSPPQPA--------------------SLHDED------AEATIAGIRARRQLSRG 2513
            :..:...|::..|.||                    ::..||      :|.:|.|..: ||.|..
  Rat   218 LDESSLFGNLLGPSPAFLDRPRLSSESSCKSWLSSLTVDSEDDYGTSVSEDSIRGAFS-RQTSTD 281

  Fly  2514 DAAKLST--SELLERAAEARN 2532
            |....|.  .|:|..|:..||
  Rat   282 DECFHSKDGDEILRNASSRRN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbgNP_001246755.1 PDZ_signaling 90..177 CDD:238492
ATP-synt_B <1084..>1109 CDD:304375
PDZ_signaling 2331..2413 CDD:238492 21/87 (24%)
PDZ_signaling 2553..2634 CDD:238492
CytipNP_001012086.1 PDZ_signaling 76..161 CDD:238492 26/104 (25%)
Interaction with CYTH1. /evidence=ECO:0000250 166..188 6/28 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.