DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbg and Stxbp4

DIOPT Version :9

Sequence 1:NP_001246755.1 Gene:bbg / 39583 FlyBaseID:FBgn0087007 Length:2637 Species:Drosophila melanogaster
Sequence 2:XP_006247190.1 Gene:Stxbp4 / 303443 RGDID:1307903 Length:557 Species:Rattus norvegicus


Alignment Length:277 Identity:60/277 - (21%)
Similarity:116/277 - (41%) Gaps:60/277 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  2313 DVQQIVEEADPPLKTPEAFIIVLQRENPESSIGITLAGGSD-YEAKEITIHKILSNTPAAKDGRL 2376
            |:......:..||:...||.::...:  |:.:|:.:.||.| .|...:.||::.......|||||
  Rat     2 DIGTSSARSSSPLERDPAFRVITVAK--ETGLGLKILGGIDRNEGPLVYIHEVTPGGDCYKDGRL 64

  Fly  2377 KKGDRILAVNGMSMRGLTHRESISVLKTPRPEVVLVVTRSESLVVKALTKKRSSLGSLSSL--NE 2439
            |.||:::::|..||.|::..|:.::|...:       .|.||.:..|..:::|..|...::  ..
  Rat    65 KPGDQLVSINKESMIGVSFEEAKNILTRAK-------LRWESPLEIAFIRQKSYCGHPGNICCQS 122

  Fly  2440 KPTELDYERKRNYHKASRSLDLDLDLVSNEAGE--SPVATTPST-GSVSP--------------- 2486
            .|...|.|.:.:          ..:|:|:.||.  ...::||.| .|:.|               
  Rat   123 PPVSEDCEPQTS----------AFNLLSSPAGTLLPKTSSTPRTQDSILPSCTVIQTQPEHSQAG 177

  Fly  2487 --PQPASLHDEDAEATIAGIR---------ARRQLSRGDAAKLSTSEL--------LERAAEARN 2532
              |.| ||::...:.:.|.|.         .:.::|...:|:|...:|        ::...|...
  Rat   178 LAPVP-SLNNRPTDTSNADIAPAWTDDASGPQGKISLNPSARLKAEKLEMALNYLGIQPTKEQHE 241

  Fly  2533 AIAAEIRAQAEDAAASG 2549
            |:..:::|.:|...:.|
  Rat   242 ALRQQVQADSEGTVSFG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbgNP_001246755.1 PDZ_signaling 90..177 CDD:238492
ATP-synt_B <1084..>1109 CDD:304375
PDZ_signaling 2331..2413 CDD:238492 23/82 (28%)
PDZ_signaling 2553..2634 CDD:238492
Stxbp4XP_006247190.1 PDZ_signaling 21..94 CDD:238492 22/74 (30%)
TPR_MLP1_2 299..400 CDD:285204
GBP_C <306..389 CDD:303769
coiled coil 359..369 CDD:293879
coiled coil 378..389 CDD:293879
WW 502..531 CDD:278809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.