powered by:
Protein Alignment bbg and Synj2bp
DIOPT Version :9
Sequence 1: | NP_001246755.1 |
Gene: | bbg / 39583 |
FlyBaseID: | FBgn0087007 |
Length: | 2637 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_079568.1 |
Gene: | Synj2bp / 24071 |
MGIID: | 1344347 |
Length: | 145 |
Species: | Mus musculus |
Alignment Length: | 66 |
Identity: | 23/66 - (34%) |
Similarity: | 44/66 - (66%) |
Gaps: | 4/66 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 2342 SSIGITLAGGSD--YEAKE--ITIHKILSNTPAAKDGRLKKGDRILAVNGMSMRGLTHRESISVL 2402
|.:|..:.||:| |.:.: |.:.:|..:..||:||||::||:||:|||..::.|.|::::.:.
Mouse 21 SGLGFNIVGGTDQQYVSNDSGIYVSRIKEDGAAAQDGRLQEGDKILSVNGQDLKNLLHQDAVDLF 85
Fly 2403 K 2403
:
Mouse 86 R 86
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.