DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbg and mpz-4

DIOPT Version :9

Sequence 1:NP_001246755.1 Gene:bbg / 39583 FlyBaseID:FBgn0087007 Length:2637 Species:Drosophila melanogaster
Sequence 2:NP_500654.1 Gene:mpz-4 / 177255 WormBaseID:WBGene00019165 Length:402 Species:Caenorhabditis elegans


Alignment Length:362 Identity:70/362 - (19%)
Similarity:131/362 - (36%) Gaps:65/362 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   978 PQDNQSIDRGTLTLSERGK----QLSEKEGLTTYTECETSEKESYLEGQQVLNGKGGFVSQDENS 1038
            |...:.:...|..|.::.|    .|..:.||.|.....:..|.:.|.|..:|...|..||.||..
 Worm    51 PNSYKMLVEATFELPKKDKITQLGLVNRHGLVTRVHYASPFKGAILPGDIILQVNGTTVSFDEKQ 115

  Fly  1039 -----DQPTYEREVSETLTIVNDGEKQVTKKLE----------QNKEIAGKKGAKLLKKTDEERR 1088
                 |:.|....:...:..|. .:...|.|.|          ..|.:.||     :..:..|.:
 Worm   116 LTEHVDETTGGASLQSNVKTVK-RKPTTTPKTEPVRAPHSLYPDFKVVVGK-----ILNSKSETK 174

  Fly  1089 LEQEAQKLIESYQKVKKEAEKLYKLELADDDQGFDLSAFEQAEEEDKPEVSEEIKEVKDSQPVKV 1153
            :.....:|     |.:....|:....||..|...||:...|.:   ..::...:::|  .:.|.|
 Worm   175 ITVLVARL-----KNRMSTSKIPNGILATQDHTIDLAILYQFK---YLQLGLNVQQV--DRKVVV 229

  Fly  1154 DIQIEEEVKTPNQVIGEVKVEDVNKEIKETVQVSQQEIKK--------EVKVSHQETKETFKSEE 1210
            :..|.:.|...:..|||..:...:|.| .|:..::|..::        .:.|.:..|........
 Worm   230 NYTIPDSVSHCSLNIGEAIIAVDDKPI-NTLADNRQRFREGFEANGWIRLLVEYPNTDPIKNMVR 293

  Fly  1211 KDESNELKIVKEEVKVTHQDLREQ-IQEIEAVKVVHKEVKVIKE------------SAKVTTTTS 1262
            ...:|.::..:....:...|:|:. ::.|||:|.......::||            .||||    
 Worm   294 GQLANVMRTAERPQYLLCGDVRKYFVEGIEALKNGKALAPILKEEEGPGEVGKKKSDAKVT---- 354

  Fly  1263 HKQATKEVIISKEDHKNDSALPAVSTTKVEIISPPLE 1299
                .|:..:...:...:..:||...:|:.:..|||:
 Worm   355 ----KKDPAVGFNNTTEEFFIPAEWNSKLFVWLPPLK 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbgNP_001246755.1 PDZ_signaling 90..177 CDD:238492
ATP-synt_B <1084..>1109 CDD:304375 3/24 (13%)
PDZ_signaling 2331..2413 CDD:238492
PDZ_signaling 2553..2634 CDD:238492
mpz-4NP_500654.1 PDZ <81..130 CDD:381812 13/48 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.