DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbg and smz-2

DIOPT Version :9

Sequence 1:NP_001246755.1 Gene:bbg / 39583 FlyBaseID:FBgn0087007 Length:2637 Species:Drosophila melanogaster
Sequence 2:NP_491965.1 Gene:smz-2 / 172415 WormBaseID:WBGene00020661 Length:274 Species:Caenorhabditis elegans


Alignment Length:225 Identity:45/225 - (20%)
Similarity:75/225 - (33%) Gaps:87/225 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KANGTTAKTA----------------TINDDYITVVEVDDPTSNPKDRLKKLVKRQSSVAEDSSF 54
            |.||...|..                |:|.|.....|::.....|:||.|.:.:|:..|.|.::.
 Worm    50 KVNGQNCKDCNDFFRALRFAAPCAKITVNRDEKKAEELEARVHIPEDRAKIIQRREGYVYELATL 114

  Fly    55 ITVLTINEMELLQQRKKEEDVGSGSSPTMEEQIENVTVFRLPGERLGFGLK-FQGGTRSTELVQK 118
            :.|                              :|       |.:||.|:| ||    :..||.:
 Worm   115 VWV------------------------------QN-------GPKLGLGIKHFQ----NRVLVSR 138

  Fly   119 LYIQSCAADSPASKVSTSWGNLRE-----GDEIVSIDGRDV--RELTRIDCVRGLKDNVAIKLVV 176
            :        .|        |:|.|     ||.:..:||..|  :::.|...|:.:::...:..||
 Worm   139 V--------DP--------GSLAEKCLVLGDHLCDVDGIPVSDKDVARDLLVKNIQEKGKVTFVV 187

  Fly   177 RNGHGQKPPSEEDPQQQEHLSITLNAQPPP 206
            ..      |...|.:|....::..|...||
 Worm   188 ER------PDSIDAKQWAKQALATNLMQPP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbgNP_001246755.1 PDZ_signaling 90..177 CDD:238492 21/94 (22%)
ATP-synt_B <1084..>1109 CDD:304375
PDZ_signaling 2331..2413 CDD:238492
PDZ_signaling 2553..2634 CDD:238492
smz-2NP_491965.1 PDZ_signaling 7..77 CDD:238492 4/26 (15%)
PDZ_signaling 114..188 CDD:238492 23/130 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.