DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and LOC5667367

DIOPT Version :10

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:XP_001688140.2 Gene:LOC5667367 / 5667367 VectorBaseID:AGAMI1_014578 Length:637 Species:Anopheles gambiae


Alignment Length:150 Identity:40/150 - (26%)
Similarity:65/150 - (43%) Gaps:21/150 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYA---RSIKLH 81
            |:|...:..|.|||:...:|..:|..:.||:|:|......|:.||:|....|..:.   |.:|..
Mosquito   164 KLCDYYRRMPVLYDKSHPHYKFQSKKEKAWRELSRLCEMDVEQCKKRMTYFRCRFTVERRIMKNG 228

  Fly    82 HGANTYYLNSELKFLQKHI---TPGVP-----------VPLRGRRSRPKGQEEHDEGDPETPVEA 132
            ...:.:.|..:||||.|||   .|..|           .|:...|.|.:.|:|    |.:..:.|
Mosquito   229 VNCSEWPLLEKLKFLNKHIKIRRPRAPNGEPDDTDDETNPMNILRKRQREQQE----DAKDDLHA 289

  Fly   133 ILEMVHSPSFLNSEHAQSRH 152
            .|::........:.|||.::
Mosquito   290 YLDLQQMAVAAQNSHAQLQY 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 25/82 (30%)
BESS 226..260 CDD:460758
LOC5667367XP_001688140.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.