DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and Adf1

DIOPT Version :9

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster


Alignment Length:197 Identity:50/197 - (25%)
Similarity:78/197 - (39%) Gaps:50/197 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VKLHPCLYDRHDDNYLRKSTVKNA--WKEISNEMRNSVKSCKERWRNIRSSYARSIKLHHGANTY 87
            |||:|.:|||...||  |..|:.|  ||:|:..:....:.|.:||:::|..:||.:||...:...
  Fly    20 VKLNPVIYDRSHYNY--KHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKLCQESRWR 82

  Fly    88 YLNSELKFLQKHITPGVPVPLRGRRSRPK--------GQEEHDEGDPETPVEAILEMVHSPSFLN 144
            |. .:::||...|          |:.|..        .|..:...||                  
  Fly    83 YF-KQMQFLVDSI----------RQYRESLLGKCANGSQSANQVADP------------------ 118

  Fly   145 SEHAQSRHSTDPASATDVEATQFNNEPSSIMDFEDTVPAEMRTESDSSEKEAKVGEIT---LYRV 206
            |:..|::..|    ..|:.|..||...::... ..|.|.|:...||:....| ||:..   .|..
  Fly   119 SQQQQAQQQT----VVDIFAQPFNGSATTSAQ-ALTHPHEITVTSDAQLATA-VGKDQKPYFYEP 177

  Fly   207 PL 208
            ||
  Fly   178 PL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 26/76 (34%)
BESS 226..260 CDD:281011
Adf1NP_001260730.1 MADF 15..95 CDD:214738 27/87 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.