DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and hng2

DIOPT Version :9

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster


Alignment Length:252 Identity:57/252 - (22%)
Similarity:96/252 - (38%) Gaps:58/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LYDRHDDNYLRKSTVKNAWKEISNEM------------RNSVKSCKERWRNIRSSYARSIKLHHG 83
            :::|...|:..:.....||::|.:|:            :..||:..:||:|.|.||.|..:|...
  Fly    31 IWERSHPNFHNRELRDEAWQQIGHELCSNFDDSSEPEKQEIVKTLLKRWKNTRDSYLRVNRLRQS 95

  Fly    84 AN-----TYYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDEGDPETPVEAILEMVHSPSFL 143
            ..     :|....||.||                ...|.:.|.|       ||::.|.....:..
  Fly    96 GEEVARASYIYEKELSFL----------------LNVKAESEDD-------VESLKEQPKPQAKR 137

  Fly   144 N--SEHAQSRHSTDPASATDVEATQFNNEPSSIMDFEDTVPAEMRT---ESDSSEKEAKVGEITL 203
            .  |..||....|.....:|.|:   |.||:.   ....:|:.:.|   :...::::....||. 
  Fly   138 KRVSTAAQRSAKTPRKRNSDQES---NIEPAI---RNPAIPSNINTVLGDLGCAKEDTATPEIA- 195

  Fly   204 YRVPLLEFP--KTSTRCIEALPIMDFDDAFLQGLRPEIKHMNFHQKLYFKRRVYDLL 258
            |...|...|  .|:|..:.|.|    |.||...::|.::.|...:||.|:..|..:|
  Fly   196 YIPQLPSDPPCSTNTAYLSADP----DQAFFDTIKPHMQQMCADRKLDFQIEVLKIL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 21/85 (25%)
BESS 226..260 CDD:281011 10/33 (30%)
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 19/81 (23%)
BESS 216..250 CDD:281011 11/37 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469748
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.