DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and CG12768

DIOPT Version :9

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001262229.1 Gene:CG12768 / 40513 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster


Alignment Length:327 Identity:63/327 - (19%)
Similarity:123/327 - (37%) Gaps:79/327 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KICHLVKLHPCLYDRHDDNYLR---KSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIKLH 81
            ::..||:|:|.|:|....:|.|   :..:|  |.|:......:.:..:..:.::|..:.|.:...
  Fly    12 RLIELVRLNPILWDCRLPHYKRSDKRKAIK--WNELGRLFNVNGERVQRTFTSLREIFRRELNHE 74

  Fly    82 HGANT--------YYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDEGDPETPVEAILEMVH 138
            ....|        ||  ..:.||::.|        |.|:||.:.:....:..|          |.
  Fly    75 KMLGTTRFKSKWEYY--DAMAFLKEVI--------RERKSRERIKHGSLDSAP----------VA 119

  Fly   139 SPSFLNSEHAQSRHSTDPASATDVEATQFNNEPSSIMD-FEDTVPAEMRTESDSSEKEAKVGEIT 202
            :.|..|:.:..||:|::            ||..|:.:| ::...|::....::..:.:.:.....
  Fly   120 TGSSNNNNNCVSRNSSN------------NNSSSAALDEYQYFAPSDPNNPNNQPQLQPEPKSSL 172

  Fly   203 LYRVPLLEFPKTSTRCIEALPI-MDFDDAFLQG--LRPEIKHMNFHQKLYFKRRVYDLL------ 258
            ...:|.|..      .:..||: :......||.  |:|::. :...||......:.:..      
  Fly   173 PVTIPSLSL------TLSQLPVALQQQAQHLQALQLQPDVT-LTSLQKQSLPTSLTNATPAPLAQ 230

  Fly   259 ---GEIFHSEQSASST----------HPAQPHPRENV--NGTLSTTSSLSSANP--LQHMGLMLQ 306
               .::..|.:|.||:          .||...|.|.:  ||..:|...|::..|  .|.:...||
  Fly   231 TSPAQVLSSSRSCSSSPSIYIKDEPCSPAGGCPEEVMTGNGPEATRKKLATIRPQTKQQLKARLQ 295

  Fly   307 LP 308
            ||
  Fly   296 LP 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 18/90 (20%)
BESS 226..260 CDD:281011 6/44 (14%)
CG12768NP_001262229.1 MADF 12..100 CDD:214738 19/99 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.