DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and stwl

DIOPT Version :9

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001261839.1 Gene:stwl / 39581 FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster


Alignment Length:334 Identity:73/334 - (21%)
Similarity:132/334 - (39%) Gaps:83/334 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 INAKICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYAR----- 76
            :|..:...|:....||||.|:||.::...:|||..:::|:..||:.||.|||.:|:.|.|     
  Fly     7 VNLMLLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRWCNAD 71

  Fly    77 SIKLHHGAN--TYYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDEGDPETPVEAILEMVHS 139
            :.:..:|..  .|.|..||:||.:|:.....:.....||....::..:..|.|..          
  Fly    72 ANRRRNGQRRLAYPLADELRFLDRHLNIADDMAADDDRSVSSDKDRDNNRDSEGV---------- 126

  Fly   140 PSFLNSEHAQS----RHSTDPASATDVE-ATQFNNEPSSIMDFED------------TVPAEMRT 187
                 ..|||:    |.|:......:|: |:|...|.||....|:            ....|...
  Fly   127 -----DHHAQASLKERASSTSKLVKEVKLASQVRKEKSSQDKRENWENPGDKQRSRKKSAEEKLN 186

  Fly   188 ESDSSEKEAKVGEITLYRVPLLEFPKTSTRCIEALPIMDFDDAFLQGLRPEIKHMNFHQKLYFKR 252
            :.:.|::..||.|:..:    |:.......|::...:.|     |:|...:::..|..::|..::
  Fly   187 DLEESDEPEKVPELDSF----LQSDNEDDECMDEEHLED-----LEGFDFDLEQSNQEKELTPEK 242

  Fly   253 RVYDLLGEIFHSEQSASSTHPAQPH--------PRENVNGTLSTTSSLSSANPLQHMGLMLQLPK 309
            .:          |::.:.:..:||.        ||..:.|..::|||.:.               
  Fly   243 SL----------EKNNTDSTVSQPEFFVKQTRDPRLLIIGRKNSTSSFAE--------------- 282

  Fly   310 LVSKASKDL 318
              |||||.:
  Fly   283 --SKASKSI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 29/86 (34%)
BESS 226..260 CDD:281011 5/33 (15%)
stwlNP_001261839.1 MADF 11..98 CDD:214738 30/86 (35%)
BESS 604..637 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 1 1.000 - - mtm6558
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.