DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and CG6683

DIOPT Version :10

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_648232.1 Gene:CG6683 / 38970 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster


Alignment Length:151 Identity:37/151 - (24%)
Similarity:60/151 - (39%) Gaps:12/151 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NAKICHLVKLHPCLYDRHDDN---YLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIK 79
            :.::..||:.:|.||:|...|   ...|......|..|:..:.:...:|..||.::.:...|.:.
  Fly     5 DTRLIELVRANPKLYERELRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQRRELA 69

  Fly    80 LHHGANT---YYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDEGDPETPVEAILEMVHSPS 141
            ......|   :.|...|||||.|..| :.....|..||...:...:..|.|.|::..::     .
  Fly    70 KEKAGGTGSDWSLLPHLKFLQHHHHP-INHRNSGDLSRSTLKSSDEVNDDEDPLQEAMD-----E 128

  Fly   142 FLNSEHAQSRHSTDPASATDV 162
            .|....|.....|:||.||.|
  Fly   129 QLAVAGAAPAPPTNPAHATPV 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 21/85 (25%)
BESS 226..260 CDD:460758
CG6683NP_648232.1 MADF 7..94 CDD:214738 22/86 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.