DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and hng1

DIOPT Version :9

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster


Alignment Length:214 Identity:44/214 - (20%)
Similarity:89/214 - (41%) Gaps:45/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIK---LH----HGANT 86
            |.|||....::......:..|.::::.:..|:...:.||..:|..|:|.:|   ||    .|.|.
  Fly    23 PSLYDPQLPSFRLSQRKEEDWAKVADLLNISISDARRRWTCLRDRYSRELKQKRLHPSGEFGHND 87

  Fly    87 YYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDEGDP--------------ETPV--EAILE 135
            ::  .::.||:..:        |.||.| :|:|...|..|              ..|:  |.::|
  Fly    88 FF--RKMDFLRDFV--------RKRRER-RGRERDREQKPTGWMKVDLQRRRRTRLPIDTETLIE 141

  Fly   136 MVHSPSFLNSEHAQSRHSTDPASATDVEATQFNNEPSSIMDFEDTVPAEMRTESD---SSEKEAK 197
            ...|.::   :..:.:|..|  :..:...|| :...|.:::.:|....|..:..:   .:|.|.|
  Fly   142 EQGSHAY---DEGEEQHDYD--AKLESHTTQ-SETYSVVVEADDGQEPEQESFDEFLGDAECEQK 200

  Fly   198 VGEITLYRVPLLEFPKTST 216
            |..:|::  |.:..|..::
  Fly   201 VKVVTIH--PEIAAPNATS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 18/77 (23%)
BESS 226..260 CDD:281011
hng1NP_611558.2 MADF 15..98 CDD:214738 18/76 (24%)
BESS 264..298 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438511
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.