DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and brwl

DIOPT Version :9

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_609298.1 Gene:brwl / 34275 FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster


Alignment Length:384 Identity:84/384 - (21%)
Similarity:138/384 - (35%) Gaps:119/384 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NAKICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIKLHH 82
            |.:..:||:.|.||||:....|..:...:.||..||.|.|.||..|||||||:|:..:|.||...
  Fly    58 NIRFVNLVRTHKCLYDKKVPEYRNRDNQEKAWVLISKETRESVIHCKERWRNLRACLSRYIKQQS 122

  Fly    83 GA----NTYYLNSELKFLQKHITPGVPVPLRGRRSRPKG----------QEEHDEGDP------- 126
            |:    ..|||...:.||       :|. |:..|:..:|          .::|.:..|       
  Fly   123 GSEPQHKPYYLTEHMAFL-------LPF-LKSSRNSLEGNNSLATLYQMSQQHLQHQPFLLHPAL 179

  Fly   127 ----------ETPVE--------------AILEMVHSPSFLNSEHAQSRHSTDPASATDVEATQF 167
                      .|.:.              .:|||.:|.|..:.|  ::..:.|||....:...:.
  Fly   180 HATEEHKYCANTSINNNNNNNDVHNGESMEVLEMKYSISEKDDE--ETIDAFDPAVTNTLGMNRT 242

  Fly   168 NNEP---SSIMDFEDTVPAEMRTESDSSEKE-------AKVGEITLYR-------VPLLEFP--- 212
            ::.|   |::.......||...|.|..|.|.       |:.|...:|.       .||...|   
  Fly   243 SSTPTRSSALQGGGGNSPARSDTASADSMKNFIPDVQLAETGSQLIYSDGGHGTPPPLHYHPHSH 307

  Fly   213 ---------------------KTSTRCIEALPIMD--------------FDDAFLQGLRPEIKHM 242
                                 :..|.| ||...|.              .|..|.:.:.|::..:
  Fly   308 PHPLTLSMDHHPASYEPGSTKRIKTEC-EATSTMTNAGSIYGGLSSSEVADMEFFRSILPDLATL 371

  Fly   243 NFHQKLYFKRRVYDLLGEIFHSEQSASSTHPAQPHPR-ENVNGTLSTTSSLSSANPLQH 300
            ...|:..||..:.:|:.::.       :.:|||.|.. ..|:|.::.:...|:...::|
  Fly   372 TPQQRRKFKIGILELIDDVV-------TRYPAQDHSNGGGVSGVVNGSGGSSNGGSVKH 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 33/83 (40%)
BESS 226..260 CDD:281011 7/47 (15%)
brwlNP_609298.1 MADF 60..145 CDD:214738 34/92 (37%)
BESS 356..389 CDD:281011 7/32 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469751
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DZH1
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.