DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and CG8119

DIOPT Version :9

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster


Alignment Length:271 Identity:54/271 - (19%)
Similarity:111/271 - (40%) Gaps:54/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PPNVYAINAKICHLVK---LHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRS 72
            |.|    |.:..||::   |.|.::|......||:..:...|.::||.:...|..||.||:::|:
  Fly     9 PTN----NLETNHLLREIALRPSIWDSRIKFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLRN 69

  Fly    73 SYARSIKLHHG-ANTYYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDEGDPETPVEAILEM 136
            :|  ..|:|.| |.::..:.:::|::....|                  |   .|:||....:::
  Fly    70 NY--RTKIHQGNAWSWPHSKQMEFVRDVFPP------------------H---KPKTPARCRVQV 111

  Fly   137 VHSPSFLN-SEHAQS--RHSTDPASATDVEATQ----FNNEPSSIMDFEDTVPAEMRTESDSSEK 194
            ..|...|: .::.||  .:|.......:.||.:    ..:||:..:|.::.|...:.|:....:.
  Fly   112 KKSKLILHPQQYLQSVASYSAFKKGGIEFEAEERLFLVTDEPAFDLDVDEEVTRLLGTDQWLWQT 176

  Fly   195 EAKVGEITLYRVP----LLEFPKTSTRCIEALPIMDFDDAFLQGLRPEIKHMNFHQKLYFKRRVY 255
            ......:.::|.|    :.:....|.|            .||..:.|.::.::...|..|:....
  Fly   177 NLDFILLPIFRAPPPSAMAKISNESNR------------HFLLSMVPMLRSLSDRSKERFRSWTR 229

  Fly   256 DLLGEIFHSEQ 266
            .:|.|:..:|:
  Fly   230 RVLREMLIAEK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 22/83 (27%)
BESS 226..260 CDD:281011 6/33 (18%)
CG8119NP_573050.1 MADF 17..97 CDD:214738 22/81 (27%)
BESS 201..234 CDD:281011 8/44 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.