DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and CG4404

DIOPT Version :9

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster


Alignment Length:325 Identity:73/325 - (22%)
Similarity:126/325 - (38%) Gaps:110/325 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NAKICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIKL-- 80
            |.:....|:..|||::.....|.:|..|:.||::::|:::::|::|:||||.||||:.||:||  
  Fly    15 NVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSLKLAR 79

  Fly    81 ---HHGANTYYLNSELKFLQKHITPGVPVPLRGRRS----------RPKGQ----EEHDE----- 123
               ..|...|||:..|:||         ||....||          |..||    ::.||     
  Fly    80 TQTGRGKRKYYLSKYLQFL---------VPFTKSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAE 135

  Fly   124 -----GDPETPVEAILEMVHSPSFLNSEHAQSRHSTDPASATDVEATQFNNEPSSIMDFE-DTVP 182
                 .|.|.|::..:.        ..||.:::.             |...:|::.:... .::.
  Fly   136 EEAKVSDGEMPLDVQVS--------EEEHRRNQE-------------QDREQPTACLPLRLHSIK 179

  Fly   183 AEMRTESDSSEKEAKVGEITLYRVPLLEF------------------------------------ 211
            .|..:.:.:.:.|..|.:.:|..||....                                    
  Fly   180 VEHDSSNANQQLERMVSQQSLVSVPAAALGNHLGWSDLTQWFKGHGSGHHKLTTTTTTPTSPPPP 244

  Fly   212 PKTSTRCIEALPIM-----------DFDDAFLQGLRPEIKHMNFHQKLYFKRRVYDLLGEIFHSE 265
            |:.:|   .||.:.           |.|.:||..|.|.||.||..|...|:::|..|:.:|..::
  Fly   245 PQPAT---SALSVFTGGPGGGGSQPDADYSFLISLHPYIKEMNGKQNRKFRQKVVGLIDDILDNK 306

  Fly   266  265
              Fly   307  306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 31/84 (37%)
BESS 226..260 CDD:281011 14/33 (42%)
CG4404NP_572838.2 MADF 17..103 CDD:214738 33/94 (35%)
BESS 267..301 CDD:281011 14/33 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469747
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DZH1
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.