DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and CG12155

DIOPT Version :10

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_572403.1 Gene:CG12155 / 31682 FlyBaseID:FBgn0029957 Length:555 Species:Drosophila melanogaster


Alignment Length:175 Identity:40/175 - (22%)
Similarity:76/175 - (43%) Gaps:36/175 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 APPPNVYAINAKICHLVKLHPCLYD-RHDDNYLRKSTVKNAWKEISNEMRN--SVKSCKERWRNI 70
            ||..::..    :.:||:.:|.||: :...|..|:|.|.|.|:|::.::.|  :|:..:.:|:|:
  Fly    16 APTDDILT----LINLVRQNPVLYNYKLQPNQRRRSDVLNGWQEVAQQIGNKYTVQEVRRKWKNL 76

  Fly    71 RSSY----ARSIKLHHG-ANTYYLNSELKFLQKHITP------------------GVPVPLRGRR 112
            |.::    .|:.|...| .:.:....||.||.|...|                  |....:.|..
  Fly    77 RDTFHQYRLRTPKYIEGRLSKWRYAKELDFLSKVYQPKLKSHRNTQITYETSGVAGAGGGIGGAN 141

  Fly   113 SR--PKGQ----EEHDEGDPETPVEAILEMVHSPSFLNSEHAQSR 151
            |.  |.|.    ::|.:.|.:..::...:..|..:.|:|.|..|:
  Fly   142 STTLPIGAMLHLKQHVDDDDDEVMDDDGQSDHDTATLSSHHGTSQ 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 25/87 (29%)
BESS 226..260 CDD:460758
CG12155NP_572403.1 MADF 24..112 CDD:214738 25/87 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.