DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and madf-9

DIOPT Version :9

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_500389.2 Gene:madf-9 / 191167 WormBaseID:WBGene00022608 Length:333 Species:Caenorhabditis elegans


Alignment Length:244 Identity:55/244 - (22%)
Similarity:97/244 - (39%) Gaps:38/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NAKICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIK--- 79
            |.::...||..|.|||:.|:.|...|...:||.||:..:..:.:..|.||:.:|..|.:..|   
 Worm    50 NIRLIAEVKARPFLYDQSDEGYNLLSWRNSAWNEIAENLETTSEHVKTRWKTLRDRYKKEEKKER 114

  Fly    80 LHHGANTYYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDEGDPE---------TPVEAILE 135
            :...|:::.....|||:|.|:           :.|...:.:.::.:|.         :|:||.:.
 Worm   115 VSKKASSWVFQRPLKFIQAHL-----------KDRHTDETDSNQSEPAVKPEPNGHVSPMEAAMS 168

  Fly   136 MVHSPSFLNSEHAQSRHST-----------DPASATDVEATQFNNEPSSIMDFEDTVPAEMRTES 189
            .:.:......:.::|..||           ..||::....||...|.|.|......:|..: |.|
 Worm   169 FIENELIRTQDSSKSSGSTGEMESSSASTASSASSSKNTGTQEGGEASVITPPPLPIPMAV-TPS 232

  Fly   190 DSSEKEAKVG--EITLYRVPLLE-FPKTSTRCIEALPIMDFDDAFLQGL 235
            .|:...|..|  .:...||.:.| ....::|...|........:|..||
 Worm   233 PSATSSASNGGPAVKRSRVSITEGMTPVASRNAAAAAAASLGLSFFPGL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 24/82 (29%)
BESS 226..260 CDD:281011 3/10 (30%)
madf-9NP_500389.2 MADF 52..136 CDD:214738 25/94 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156208
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4048
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.