DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and madf-8

DIOPT Version :9

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_497739.1 Gene:madf-8 / 183517 WormBaseID:WBGene00008118 Length:300 Species:Caenorhabditis elegans


Alignment Length:160 Identity:32/160 - (20%)
Similarity:65/160 - (40%) Gaps:28/160 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 APPPNVYAINAKICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEM----RNSVKSCKERWRN 69
            |.|..||    .|.:.|:..|.|:|:....:...:..:.||.::..|:    ...:...|:.|::
 Worm   128 AEPEKVY----DIIYAVRKRPILWDQRLICHRNSNLSRRAWDQLDLELGIDEEYPLARRKQIWKS 188

  Fly    70 IRSSYARSIKLHHGANTYYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDE----------- 123
            .|..:..::...:.....|.:: |:|.:..|.......||...::| .|..||:           
 Worm   189 KRDYFVSAVNAANLRKWIYADA-LEFYRPMINFRTTFCLRPTVAQP-SQSVHDKLVLADKNIQCT 251

  Fly   124 -GDPETPVEAILEMVH-----SPSFLNSEH 147
             ||.:..:..:|:.::     ||..: :||
 Worm   252 PGDKKNVLTFLLKSLYDTGMSSPEMM-AEH 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 14/83 (17%)
BESS 226..260 CDD:281011
madf-8NP_497739.1 MADF 135..219 CDD:214738 14/84 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156212
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.