DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and madf-5

DIOPT Version :9

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_497028.1 Gene:madf-5 / 175118 WormBaseID:WBGene00007242 Length:423 Species:Caenorhabditis elegans


Alignment Length:339 Identity:76/339 - (22%)
Similarity:128/339 - (37%) Gaps:100/339 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AINAKICHLVKLHPCLYDRHDDNYLRKST-----VKNAWKEISNEMRNSVKSC-----KERWRNI 70
            |.||::.:.|:.:||||     |:.|:.:     .:..|:.|:   :|...:|     |:||..:
 Worm     6 AFNARLINEVRKYPCLY-----NHSRRGSGDTMERQRLWESIA---KNIDPNCAAEFAKKRWLQL 62

  Fly    71 RSSYARSIK--LHHGANT----YYLNSELK----FLQKHI------------------TPGVPVP 107
            |..|.:.:|  :.:|..|    .|.| :|.    ||:.:|                  ..|.|..
 Worm    63 RDRYRKELKIAIKNGFVTPVRWCYFN-QLSWLDPFLKDNIGQAADEGKKTGKSDSFDEPSGTPFS 126

  Fly   108 LRG--RRSRPKGQEEHDEGDPETPVEAILEMVHSPSFLNSEHAQSRHSTDPASATDVEATQF--- 167
            ..|  ..:..|.:.|.|:.||... .::|:.      |.::.||...|..|....|...||.   
 Worm   127 WFGFPNLNSIKDEMEDDDSDPALE-SSVLDR------LLAQTAQRLDSISPEIENDESGTQSLDG 184

  Fly   168 ----------NNEPSSIMDFEDTV----PAEMRTESDSSE--KE---AKVGEITLYRVPLLEFPK 213
                      ..|...|.| ||.|    |.:::::|::..  ||   |:..:.|.....:.:..:
 Worm   185 NLDGVDGDGDEEEDLKIKD-EDEVEEDGPEKVKSQSEAMAMLKEAISAQSQQQTQQAQQVQQVQQ 248

  Fly   214 TSTR-CIEALPIMDFDDAFLQGLRPEIKHMNFHQKLYFKRRVYDLLGEIFHSEQSA-SSTHPAQP 276
            |..: .:|:| |......|...|..::..|:            .:|.....||::| ....|:.|
 Worm   249 TPQKPSVESL-IAANQARFAHHLAAQLTGMS------------SMLNGARKSEEAAIPPLRPSTP 300

  Fly   277 HPRENVNGTLSTTS 290
            .|      |.||||
 Worm   301 PP------TASTTS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 24/99 (24%)
BESS 226..260 CDD:281011 4/33 (12%)
madf-5NP_497028.1 MADF 10..98 CDD:214738 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.