DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3919 and si:ch73-59f11.3

DIOPT Version :9

Sequence 1:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001315046.1 Gene:si:ch73-59f11.3 / 107988036 ZFINID:ZDB-GENE-131121-446 Length:180 Species:Danio rerio


Alignment Length:197 Identity:56/197 - (28%)
Similarity:81/197 - (41%) Gaps:45/197 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNTRRRSIAPPPNVYAINAKICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMR-NSVKSCK 64
            |||..|.:|             .||||:|.|||....::.....|.|:||||:.::. ::.::||
Zfish     1 MNTPERRVA-------------ELVKLYPHLYDHSLRDFKVPEKVFNSWKEIATKLGIDNPETCK 52

  Fly    65 ERWRNIRSSYARSIK--LHHG----ANTYYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDE 123
            ..|||||..:::::|  |..|    |....|..|||:|:..      |.||..........|.:.
Zfish    53 STWRNIRDKFSKAMKRMLRKGGDEDARVPRLFVELKWLRPF------VRLRANTVSDTPCFEFEI 111

  Fly   124 GDPETPVEAILEMVHSPSFLNSE-----------------HAQSRHSTDPASATDVEATQFNNEP 171
            .:.|||...:.|...|.|...:|                 .|..|.|:.|..|  |.:|.....|
Zfish   112 QNEETPKNMVAEESSSSSGCTNESDVEGRCSAASLDAFGTSALHRLSSTPCEA--VTSTIAQPSP 174

  Fly   172 SS 173
            ||
Zfish   175 SS 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3919NP_001261840.1 MADF 20..100 CDD:214738 30/86 (35%)
BESS 226..260 CDD:281011
si:ch73-59f11.3NP_001315046.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6558
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.