Sequence 1: | NP_001261840.1 | Gene: | CG3919 / 39582 | FlyBaseID: | FBgn0036423 | Length: | 318 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001315046.1 | Gene: | si:ch73-59f11.3 / 107988036 | ZFINID: | ZDB-GENE-131121-446 | Length: | 180 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 56/197 - (28%) |
---|---|---|---|
Similarity: | 81/197 - (41%) | Gaps: | 45/197 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MNTRRRSIAPPPNVYAINAKICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMR-NSVKSCK 64
Fly 65 ERWRNIRSSYARSIK--LHHG----ANTYYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDE 123
Fly 124 GDPETPVEAILEMVHSPSFLNSE-----------------HAQSRHSTDPASATDVEATQFNNEP 171
Fly 172 SS 173 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3919 | NP_001261840.1 | MADF | 20..100 | CDD:214738 | 30/86 (35%) |
BESS | 226..260 | CDD:281011 | |||
si:ch73-59f11.3 | NP_001315046.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | mtm6558 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |