DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stwl and zgc:152938

DIOPT Version :9

Sequence 1:NP_001261839.1 Gene:stwl / 39581 FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_001070756.1 Gene:zgc:152938 / 768145 ZFINID:ZDB-GENE-061013-458 Length:292 Species:Danio rerio


Alignment Length:221 Identity:48/221 - (21%)
Similarity:94/221 - (42%) Gaps:33/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRWCNAD-ANR 74
            |:..|..:..|:|:...:|:.....|..|..:|.::|..|:..|.:|:.||:.|.|....| ...
Zfish    60 LISLVSDRRELFDQNHIDYKHIDKREALWQEIAEKIGFHVDDVKTKWKNLRDTYIRKKREDQCTG 124

  Fly    75 RRNGQRRLAYPLADELRFL-----DRHLNIADDMAADD--DRSVSSDKDRDNNRDSEGVDHHAQA 132
            .:..:::..:.....:.||     .|.::.:...:||:  |.| .|:|....:.:|.......||
Zfish   125 EQTPKKKKTWKFMKMMEFLATSSEQRRVHSSVKESADEVGDGS-ESEKSLSISVESAVSSEPVQA 188

  Fly   133 SLKERASS-TSKLVKEVKLASQVRKEKSSQDKRENWEN----------------PGDKQRSRKKS 180
            :.|:|..| |...|::...|.:||..:..:.:::..|:                |..||.|.|..
Zfish   189 NSKKRKRSVTPDFVEKYLAAKEVRDREREECRKQRMEDDISLFLMSLAPVIRRLPPSKQSSVKMR 253

  Fly   181 AEEKLNDLE----ESDEP---EKVPE 199
            ..:.|:::|    ::.:|   :..||
Zfish   254 FHQVLHEVEYGLSDASQPPSAQHCPE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 20/92 (22%)
BESS 604..637 CDD:281011
zgc:152938NP_001070756.1 MADF_DNA_bdg 60..128 CDD:287510 17/67 (25%)
BESS 226..260 CDD:281011 6/33 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.