Sequence 1: | NP_001261839.1 | Gene: | stwl / 39581 | FlyBaseID: | FBgn0003459 | Length: | 1037 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001070756.1 | Gene: | zgc:152938 / 768145 | ZFINID: | ZDB-GENE-061013-458 | Length: | 292 | Species: | Danio rerio |
Alignment Length: | 221 | Identity: | 48/221 - (21%) |
---|---|---|---|
Similarity: | 94/221 - (42%) | Gaps: | 33/221 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 LLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRWCNAD-ANR 74
Fly 75 RRNGQRRLAYPLADELRFL-----DRHLNIADDMAADD--DRSVSSDKDRDNNRDSEGVDHHAQA 132
Fly 133 SLKERASS-TSKLVKEVKLASQVRKEKSSQDKRENWEN----------------PGDKQRSRKKS 180
Fly 181 AEEKLNDLE----ESDEP---EKVPE 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
stwl | NP_001261839.1 | MADF | 11..98 | CDD:214738 | 20/92 (22%) |
BESS | 604..637 | CDD:281011 | |||
zgc:152938 | NP_001070756.1 | MADF_DNA_bdg | 60..128 | CDD:287510 | 17/67 (25%) |
BESS | 226..260 | CDD:281011 | 6/33 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1634040at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0001895 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |