DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stwl and si:ch211-207i20.3

DIOPT Version :9

Sequence 1:NP_001261839.1 Gene:stwl / 39581 FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:XP_683419.5 Gene:si:ch211-207i20.3 / 555734 ZFINID:ZDB-GENE-141222-71 Length:263 Species:Danio rerio


Alignment Length:220 Identity:51/220 - (23%)
Similarity:93/220 - (42%) Gaps:24/220 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MLLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRWCNADANR 74
            :||..|.:...|:|:....|:.....|..|..:|.::|..||:.|.:|:.||:.|||....:.:.
Zfish    34 LLLFLVSENKELFDKNHSEYKNTKRKEALWQGIADKMGVDVEEVKAKWKNLRDTYTRKKRLEQDG 98

  Fly    75 RRNG---QRRLAYPLADELRFLD----RHLNIADDMAADDDRSVSSDKDRDNNRDSEGV---DHH 129
            .|:|   :::..:.....:.|||    ....|.|....||:....|..:..:......|   :..
Zfish    99 SRSGRAAKKKKQWKYMRVMDFLDPATEHRSGILDSKIEDDEPDEDSGAEPASTSTGTSVTSPEAM 163

  Fly   130 AQASLKERASSTSKLVKE---VKLASQVRKEKSSQDKRENW---------ENPGDKQRSRKKSAE 182
            ..:.:|.|.|.|.:|:::   .|.|....|::..||:.:.:         ..|..||...|...:
Zfish   164 RSSIVKRRRSETLELLEKYLATKDAKDREKDEQQQDEVDLFLRSLAPALRRLPASKQSLVKLQIQ 228

  Fly   183 EKLNDLEESDEPEKVPELDSFLQSD 207
            :.|:| .|..:| ..|::.|...|:
Zfish   229 KILHD-AEFGQP-SFPQISSVSPSN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 24/93 (26%)
BESS 604..637 CDD:281011
si:ch211-207i20.3XP_683419.5 MADF 35..122 CDD:214738 23/86 (27%)
BESS 199..233 CDD:308542 6/33 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.