DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stwl and hng3

DIOPT Version :9

Sequence 1:NP_001261839.1 Gene:stwl / 39581 FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_612057.1 Gene:hng3 / 38090 FlyBaseID:FBgn0035160 Length:333 Species:Drosophila melanogaster


Alignment Length:277 Identity:58/277 - (20%)
Similarity:107/277 - (38%) Gaps:71/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTR--------- 66
            |:..|:::.||:|....::..|..::..|:.||...|..||.|:.:|:.||..|.|         
  Fly     6 LIFEVQQRRALWDARHPDHANRPETQRLWNAVAEATGMDVELCRTKWKNLRCSYRRSNRRSGILK 70

  Fly    67 ----------WCNADA-----------NRRRNGQRRLAYPLADELR-------FLDRHLNIADDM 103
                      |..|:|           :...||:..:...|..|..       |....::.||:|
  Fly    71 HQQSPSPGHQWSYAEAMSFLDGQREECDNSNNGEEEMESALKIEAEHMPMLSTFKSEQVSAADEM 135

  Fly   104 AADDDRSVSSDKDRDNNRDSEGVDHHAQASLKERASSTSKLVKEVKLASQVRKEK--SSQDKREN 166
            .||:|..:         |:.:.|         ....:..:|.:.:.|||...:|:  |:.|:...
  Fly   136 EADNDALM---------REFQNV---------STPQALRRLSENISLASAAAEEQVPSTADQLSP 182

  Fly   167 WENPGDKQRSR-------KKSAEEKLNDLEESDEPEKVPELDSFLQSDNED-DECMDEEHLEDLE 223
            ..|.|....:.       .|..:|::|.||..:..|:     ..:||.::| ..|....|:.|.:
  Fly   183 NLNQGSAIAAAAASSCHCAKRVDEQVNFLESLEREEQ-----QLMQSTSQDLARCKSVLHVGDSD 242

  Fly   224 GFDFDLEQSNQEKELTP 240
             :::.:......|::||
  Fly   243 -YNYLISFLPLMKQMTP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 26/123 (21%)
BESS 604..637 CDD:281011
hng3NP_612057.1 MADF 5..91 CDD:214738 21/84 (25%)
BESS 240..274 CDD:281011 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.