DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment stwl and CG8119

DIOPT Version :9

Sequence 1:	NP_001261839.1	Gene:	stwl / 39581	FlyBaseID:	FBgn0003459	Length:	1037	Species:	Drosophila melanogaster
Sequence 2:	NP_573050.1	Gene:	CG8119 / 32500	FlyBaseID:	FBgn0030664	Length:	244	Species:	Drosophila melanogaster

Alignment Length:	56	Identity:	21/56 - (37%)
Similarity:	37/56 - (66%)	Gaps:	4/56 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly    11 LLRSVEKQTALYD-RTDENYRK-RLPSENAWDMVASEVGESVEKCKRRWRQLRNDY 64
            |||.:..:.:::| |...:.|: ::|.:  |..|::.||..|::|||||:.|||:|
  Fly    18 LLREIALRPSIWDSRIKFSLRRPQIPID--WLDVSNAVGLGVDECKRRWKSLRNNY 71

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
stwl	NP_001261839.1	MADF	11..98	CDD:214738	21/56 (38%)
stwl	NP_001261839.1	BESS	604..637	CDD:281011
CG8119	NP_573050.1	MADF	17..97	CDD:214738	21/56 (38%)
CG8119	NP_573050.1	BESS	201..234	CDD:281011
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1634040at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.010