DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stwl and CG8119

DIOPT Version :10

Sequence 1:NP_524068.2 Gene:stwl / 39581 FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster


Alignment Length:56 Identity:21/56 - (37%)
Similarity:37/56 - (66%) Gaps:4/56 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLRSVEKQTALYD-RTDENYRK-RLPSENAWDMVASEVGESVEKCKRRWRQLRNDY 64
            |||.:..:.:::| |...:.|: ::|.:  |..|::.||..|::|||||:.|||:|
  Fly    18 LLREIALRPSIWDSRIKFSLRRPQIPID--WLDVSNAVGLGVDECKRRWKSLRNNY 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwlNP_524068.2 MADF 11..98 CDD:214738 21/56 (38%)
COG5177 <131..>267 CDD:227504
BESS 604..637 CDD:460758
CG8119NP_573050.1 MADF 17..97 CDD:214738 21/56 (38%)
BESS 201..234 CDD:460758
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.