DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stwl and madf-4

DIOPT Version :9

Sequence 1:NP_001261839.1 Gene:stwl / 39581 FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_505565.3 Gene:madf-4 / 179386 WormBaseID:WBGene00011575 Length:329 Species:Caenorhabditis elegans


Alignment Length:226 Identity:48/226 - (21%)
Similarity:90/226 - (39%) Gaps:29/226 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EVNLMLLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEV---GESVEKCKRRWRQLRNDYTRW 67
            :..|.|:.||::...:|:|.|..::........|.:::.|:   |:.|| .:|:|:.:|:.|.|.
 Worm    17 DFTLALIDSVQRNPCVYNRYDPLHKVTDYKHEIWKLISIEIGYDGQPVE-LERKWKHMRDKYVRL 80

  Fly    68 CNADANRRRNGQRRLAYPLADELRFLDRHLNIADDMAADDDRSVSSDKDRDNNRDSEGVDHHAQ- 131
            ...|..:....:....|....::.|||.::         :.|:....||..|:...:.:|.... 
 Worm    81 RKQDKQKAPIKKTNKWYNYYHKMSFLDPYV---------EHRNRKRQKDYLNSNTPDFLDDDTAF 136

  Fly   132 ---ASLKERASSTSKLVKEVKLASQVRKEKSSQDKRENWENPGDKQRSRKKSAEEKLNDLEESDE 193
               .|:||.....|.|.......:......||.....|  |.|       :..:....|:|: |:
 Worm   137 LDGLSVKEMLKPESLLTSNDAGYNSPHTTSSSSSSGSN--NNG-------RFLDSPTIDIED-DK 191

  Fly   194 PEKVPELDSFL--QSDNEDDECMDEEHLEDL 222
            .......|.|:  |::||.:.....:|.:||
 Worm   192 KNLALIYDKFVANQTENEKNHRFSNKHGKDL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 21/89 (24%)
BESS 604..637 CDD:281011
madf-4NP_505565.3 MADF 22..111 CDD:214738 21/98 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.