DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stwl and madf-2

DIOPT Version :9

Sequence 1:NP_001261839.1 Gene:stwl / 39581 FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_492896.1 Gene:madf-2 / 173019 WormBaseID:WBGene00009461 Length:290 Species:Caenorhabditis elegans


Alignment Length:285 Identity:60/285 - (21%)
Similarity:98/285 - (34%) Gaps:86/285 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 RASSTSKLVKEVKLASQVRKEKSSQDKRENWENPGDKQRSRKKSAEEKLNDLEESDEPE-KVPEL 200
            :.|...::..|:....|:..:.:.:|.|..|:|..|....:.:...|.....:...||. |...:
 Worm    37 KTSCLREVTSELNSMFQMPIKFTCEDVRSQWKNLKDTFVRKLRWVHEGKYMEDAMKEPTWKFYRM 101

  Fly   201 DSFL---QSDNEDDECMDEEHLEDLEGFDFDLEQSNQ---EKELTPEKSLEKNNTDSTVSQPEFF 259
            .:||   ::....|.|   ||..:|........|..|   |...|.||..:..|     :||   
 Worm   102 LTFLDEKEAKRLGDTC---EHTYELAPNSTSCGQRAQISYEPTSTEEKMFQMFN-----NQP--- 155

  Fly   260 VKQTRDPRLLIIGRKNSTSSFAESKASKSISGDPLETAMEDSGDEYGRDGEKRVTGSDTT----- 319
                 .|:|       |..|..:|....:.|.:|..|:           ....||.|.:.     
 Worm   156 -----PPQL-------SQQSMIDSSQIATCSNEPKMTS-----------SSTFVTSSTSLKRGVH 197

  Fly   320 -SPTRRPRRAARASISFAGIRDL---PIQKPGQAQRMTRLQRRKSMSLAAVHSVRSSTSPVKMTP 380
             ||||.|..      |.:|:.:.   ..::||         |:|        |.|...|.::  |
 Worm   198 YSPTRSPNG------SSSGLEEELEDEDEQPG---------RKK--------SCRRQVSNIQ--P 237

  Fly   381 VPRSQPINKPPSGPVQITKISHRDD 405
            :   |.|..||        ::|:|:
 Worm   238 M---QVITTPP--------VAHQDE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738
BESS 604..637 CDD:281011
madf-2NP_492896.1 MADF 11..107 CDD:214738 14/69 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.