DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stwl and LOC110439798

DIOPT Version :9

Sequence 1:NP_001261839.1 Gene:stwl / 39581 FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:XP_021332041.1 Gene:LOC110439798 / 110439798 -ID:- Length:273 Species:Danio rerio


Alignment Length:262 Identity:71/262 - (27%)
Similarity:101/262 - (38%) Gaps:57/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AASEVNLMLLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRW 67
            ||.|.   |||:|.:...|::|...:||.....|..|..||:.:|.||.:|||||:.:|:.|.|.
Zfish    27 AAEET---LLRAVYRIPLLHNRLRTDYRSTERRERVWRDVAASIGLSVVECKRRWKTIRDRYIRE 88

  Fly    68 CNADANRRRNGQRRLAY-PLADELRFLDRHLNIADDMAADDDRSVSSDKDRDNNRDS-------E 124
            ......::..|.|||.| |..:.|.|||.|:                   |...|.|       |
Zfish    89 RRLCKLKKDLGGRRLHYWPHRESLAFLDAHI-------------------RKRRRPSGAQGPEEE 134

  Fly   125 GVDHHAQASLKER---------ASSTSKLVK-----EVKLASQVRKEKSSQDKRENWENPGDKQR 175
            ..:.|:.|:|:|.         .|.:|:.|.     .:.:.:|::..............||.|..
Zfish   135 QQEEHSSAALQEDKEECVQEECVSDSSRFVSPLNPLPLSIVTQLKPVPQVSPLLLTSLPPGLKVA 199

  Fly   176 SRKKSAEEKLNDLEESDEPEKVPELDSFLQSDNEDDECMDEEHLEDLEGFDFDLEQSNQEKELTP 240
            ....||...| ....|..|..||     |:.....|..:||:.|       |.|......|.|||
Zfish   200 PASSSAPPLL-PASASAGPLNVP-----LEEQQRADGALDEDQL-------FLLSYVPALKRLTP 251

  Fly   241 EK 242
            :|
Zfish   252 QK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 34/87 (39%)
BESS 604..637 CDD:281011
LOC110439798XP_021332041.1 MADF 32..120 CDD:214738 34/106 (32%)
BESS 233..267 CDD:308542 10/28 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.