DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stwl and LOC110438041

DIOPT Version :9

Sequence 1:NP_001261839.1 Gene:stwl / 39581 FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:XP_021323091.1 Gene:LOC110438041 / 110438041 -ID:- Length:277 Species:Danio rerio


Alignment Length:167 Identity:40/167 - (23%)
Similarity:67/167 - (40%) Gaps:47/167 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 PQSPI-NTKVLTIGKPTSSVASGNINNIAIKSNVVTSISSSTATTNTITKGTSNNSIKTTENVNV 541
            |.||: :|.||    ||             :|.:|.:.||:.......:|...:..:.:..:|..
Zfish   145 PSSPVPSTPVL----PT-------------QSTLVPATSSTPPPPCPSSKCYPSPCLVSAFSVPN 192

  Fly   542 ISYSPNSSSTSSSSKATTGASGAVITNIPTTTTAGTSVPVGKSITQ---LKMTERGTQTGVQNPF 603
            ||.|||:|.:||.                       .:|..||.::   |.|.|:...|..:.|.
Zfish   193 ISPSPNASPSSSE-----------------------LMPKRKSTSEACLLNMLEQMEWTREKTPH 234

  Fly   604 SDN---YFLEMIKPQMQEMNPRQKMHFKKKVFQALME 637
            .|:   .|..::...:.:::||.|...|.|::|.|.|
Zfish   235 QDSEDFRFASVVVDMLAKIDPRMKSEVKFKIYQMLYE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738
BESS 604..637 CDD:281011 9/35 (26%)
LOC110438041XP_021323091.1 MADF_DNA_bdg 10..77 CDD:313715
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6558
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.