DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stwl and si:ch73-59f11.3

DIOPT Version :9

Sequence 1:NP_001261839.1 Gene:stwl / 39581 FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_001315046.1 Gene:si:ch73-59f11.3 / 107988036 ZFINID:ZDB-GENE-131121-446 Length:180 Species:Danio rerio


Alignment Length:154 Identity:38/154 - (24%)
Similarity:68/154 - (44%) Gaps:44/154 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LYDRTDENYRKRLPSE--NAWDMVASEVG-ESVEKCKRRWRQLRNDYTRWCNADANR---RRNGQ 79
            |||.:..::  ::|.:  |:|..:|:::| ::.|.||..||.:|:.:::     |.:   |:.|.
Zfish    18 LYDHSLRDF--KVPEKVFNSWKEIATKLGIDNPETCKSTWRNIRDKFSK-----AMKRMLRKGGD 75

  Fly    80 RRLAYP-LADELRFLD-----RHLNIAD---------------DMAADDDRSVSSDKDRDNNRDS 123
            .....| |..||::|.     |...::|               :|.|::.   ||.....|..|.
Zfish    76 EDARVPRLFVELKWLRPFVRLRANTVSDTPCFEFEIQNEETPKNMVAEES---SSSSGCTNESDV 137

  Fly   124 EG------VDHHAQASLKERASST 141
            ||      :|....::| .|.|||
Zfish   138 EGRCSAASLDAFGTSAL-HRLSST 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwlNP_001261839.1 MADF 11..98 CDD:214738 23/88 (26%)
BESS 604..637 CDD:281011
si:ch73-59f11.3NP_001315046.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6558
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.