DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13481 and AT3G28620

DIOPT Version :9

Sequence 1:NP_001097605.1 Gene:CG13481 / 39579 FlyBaseID:FBgn0036421 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_189503.1 Gene:AT3G28620 / 822492 AraportID:AT3G28620 Length:211 Species:Arabidopsis thaliana


Alignment Length:181 Identity:45/181 - (24%)
Similarity:74/181 - (40%) Gaps:44/181 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSNSSESLNKMK--SLVGKMIFMQVTEHLFLR--AQQLLDSDVSIEERVRRMEVLNNNMKWFNSE 62
            ||.|.:.|..:|  |.....::.::..||...  ::||....|..::|.:|              
plant    57 SSTSHDPLISLKLPSFKPNDVYQRLQTHLHDHDLSEQLSYKIVQAQQRQKR-------------- 107

  Fly    63 RTRILEQLQLNIFGQISVE-HHNAMN-MSENLYELREGLDGLSRRMESMQEDITCSICLSPWSSN 125
            ::..|.| |..:|..:||: .|...| :|.:...|....|..|:: |..:|..||:|||..    
plant   108 QSFYLPQ-QRPLFMIVSVKLTHKVYNVVSCDSAPLATDFDQESQQ-EEEEESKTCAICLEN---- 166

  Fly   126 GRHRVVSLR---------CGHLFGNSCIRTAIRR-SHRCPICRRRA--LHA 164
                  .||         |.|.|...|:...:.| ::.||:||:..  ||:
plant   167 ------LLRSEDYCEMPTCSHYFHEPCLTEWLTRDNNSCPLCRKPVDKLHS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13481NP_001097605.1 zf-RING_2 114..158 CDD:290367 14/53 (26%)
AT3G28620NP_189503.1 RING_Ubox 159..203 CDD:388418 14/53 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2695
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.