DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13481 and RFWD3

DIOPT Version :9

Sequence 1:NP_001097605.1 Gene:CG13481 / 39579 FlyBaseID:FBgn0036421 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001357463.1 Gene:RFWD3 / 55159 HGNCID:25539 Length:774 Species:Homo sapiens


Alignment Length:152 Identity:45/152 - (29%)
Similarity:74/152 - (48%) Gaps:36/152 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FNSE-RTRILEQLQLNIF----GQISVEHHNAMNMSE--NLYELREGLDGLSRRME--------- 107
            ::|| |..:.|:||::..    ...|.|:...::.:|  ....|.|.|.|:|...|         
Human   196 YDSETRNPVSEELQVSSSSDSDSDSSAEYGGVVDQAEESGAVILEEQLAGVSAEQEVTCIDGGKT 260

  Fly   108 -----------------SMQED--ITCSICLSPWSSNGRHRVVSLRCGHLFGNSCIRTAIR-RSH 152
                             ||.|:  .||:|||..|::.|.||:.:||||||||..||.|.:: :..
Human   261 LPKQPSPQKSEPLLPSASMDEEEGDTCTICLEQWTNAGDHRLSALRCGHLFGYRCISTWLKGQVR 325

  Fly   153 RCPICRRRALHADVRRIFSRRI 174
            :||.|.::|.|:|:..:::|.:
Human   326 KCPQCNKKARHSDIVVLYARTL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13481NP_001097605.1 zf-RING_2 114..158 CDD:290367 22/44 (50%)
RFWD3NP_001357463.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..116
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..225 8/28 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..280 1/22 (5%)
mRING-C3HGC3_RFWD3 283..331 CDD:319364 22/47 (47%)
WD40 <486..774 CDD:225201
WD 1 495..537
WD40 repeat 500..537 CDD:293791
WD 2 539..577
WD40 repeat 543..580 CDD:293791
WD 3 583..628
WD40 repeat 588..655 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146167
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.