DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13481 and ARK2C

DIOPT Version :10

Sequence 1:NP_001097605.1 Gene:CG13481 / 39579 FlyBaseID:FBgn0036421 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_689683.2 Gene:ARK2C / 494470 HGNCID:31696 Length:346 Species:Homo sapiens


Alignment Length:68 Identity:24/68 - (35%)
Similarity:32/68 - (47%) Gaps:4/68 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 YELREGLDGLSRRMESMQEDI--TCSICLSPWSSNGRHRVVSLRCGHLFGNSCIRTAIRRSHRCP 155
            |:.|...||..::.|..:.|.  .|:||||.....  ..|..|.|.|||...|:...:..|.:||
Human   270 YKKRRPQDGKGKKDEGEESDTDEKCTICLSMLEDG--EDVRRLPCMHLFHQLCVDQWLAMSKKCP 332

  Fly   156 ICR 158
            |||
Human   333 ICR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13481NP_001097605.1 mRING-C3HGC3_RFWD3 111..170 CDD:438114 19/50 (38%)
ARK2CNP_689683.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..76
Ubiquitin binding. /evidence=ECO:0000269|PubMed:26656854, ECO:0007744|PDB:5D0K 266..268
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..288 5/17 (29%)
RING-H2_RNF165 285..343 CDD:438344 19/53 (36%)
Ubiquitin binding. /evidence=ECO:0000269|PubMed:26656854, ECO:0007744|PDB:5D0K 309..313 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.