DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13481 and CG13025

DIOPT Version :9

Sequence 1:NP_001097605.1 Gene:CG13481 / 39579 FlyBaseID:FBgn0036421 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001261971.1 Gene:CG13025 / 39874 FlyBaseID:FBgn0036660 Length:608 Species:Drosophila melanogaster


Alignment Length:86 Identity:36/86 - (41%)
Similarity:53/86 - (61%) Gaps:6/86 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LREGLDGLSRRMESMQEDITCSICLSPWSSNGRHRVVSLRCGHLFGNSCIRTAIRRSHR------ 153
            |::..:|....::...:.:||.|||..|..:|.||:||||||||||.||||..:..|||      
  Fly   111 LKKSPEGKPIVVDDEDDGMTCPICLDSWEMSGEHRLVSLRCGHLFGESCIRRWLNESHRQSSVKV 175

  Fly   154 CPICRRRALHADVRRIFSRRI 174
            ||.|:.:|...|:|.::::||
  Fly   176 CPQCKTKATFRDIRHLYAKRI 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13481NP_001097605.1 zf-RING_2 114..158 CDD:290367 28/49 (57%)
CG13025NP_001261971.1 zf-RING_2 130..180 CDD:290367 28/49 (57%)
WD40 <293..445 CDD:295369
WD40 <318..>415 CDD:225201
WD40 repeat 339..375 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447444
Domainoid 1 1.000 54 1.000 Domainoid score I4143
eggNOG 1 0.900 - - E1_KOG1645
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3563
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.