DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13481 and CG14983

DIOPT Version :9

Sequence 1:NP_001097605.1 Gene:CG13481 / 39579 FlyBaseID:FBgn0036421 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_647843.1 Gene:CG14983 / 38466 FlyBaseID:FBgn0035479 Length:163 Species:Drosophila melanogaster


Alignment Length:140 Identity:50/140 - (35%)
Similarity:75/140 - (53%) Gaps:13/140 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LLDSDVSIEERVRRMEVLNNNMKWFNSERTRILEQLQLNI----FGQISVEHHNAMNMSENLYEL 95
            |.:|..|.|:|:.::|.:.:.|..::|.|..||..||..:    :..:.|.|         :.:.
  Fly    26 LEESFASPEQRLAQLESVTSRMHLYHSRRGNILMSLQQELGKYEYFTLLVRH---------IAQT 81

  Fly    96 REGLDGLSRRMESMQEDITCSICLSPWSSNGRHRVVSLRCGHLFGNSCIRTAIRRSHRCPICRRR 160
            ...|..|::.::.:.:...||||......:|||.:||||||||||..||...:|.|.|||.|.||
  Fly    82 HSYLKSLNKALDFLYKVNICSICDLKCEPHGRHSMVSLRCGHLFGRHCINNVLRESSRCPTCSRR 146

  Fly   161 ALHADVRRIF 170
            |.|.:||||:
  Fly   147 ARHHEVRRIY 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13481NP_001097605.1 zf-RING_2 114..158 CDD:290367 24/43 (56%)
CG14983NP_647843.1 zf-RING_2 99..143 CDD:290367 24/43 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447437
Domainoid 1 1.000 54 1.000 Domainoid score I4143
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2695
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.