DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13481 and CG31807

DIOPT Version :9

Sequence 1:NP_001097605.1 Gene:CG13481 / 39579 FlyBaseID:FBgn0036421 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_723984.1 Gene:CG31807 / 318953 FlyBaseID:FBgn0051807 Length:155 Species:Drosophila melanogaster


Alignment Length:169 Identity:55/169 - (32%)
Similarity:92/169 - (54%) Gaps:19/169 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSNSSESLNKMKSLVGKMIFMQVTEHLFLRAQQLLDSDVSIEERVRRMEVLNNNMKWFNSERTR 65
            |.:|.:::.:.|:.|...::            :|||......|::.:::..||..    ..|:.:
  Fly     1 MPNNKAQTRSLMRMLKKDVV------------EQLLAERKKSEQKDKQLAKLNIT----TQEKDK 49

  Fly    66 ILEQLQLNIFGQISVEHHNAMNMSENLYELREGLDGLSRRMESMQEDITCSICLSPWSSNGRHRV 130
            :.|: :|.::.|:..|..|...:.|.|  |.|..|.|::::|.:..:.||.|||.||.:...||:
  Fly    50 MREE-ELKLYYQMEEEITNQKLLQEQL--LFESKDELTQQLEKIAIENTCCICLDPWEAKDHHRL 111

  Fly   131 VSLRCGHLFGNSCIRTAIRRSHRCPICRRRALHADVRRI 169
            ||||||||||..||||.::.:..|||||:.|:..||.|:
  Fly   112 VSLRCGHLFGEMCIRTHLQHADMCPICRKVAIERDVWRV 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13481NP_001097605.1 zf-RING_2 114..158 CDD:290367 26/43 (60%)
CG31807NP_723984.1 zf-RING_2 94..139 CDD:290367 26/44 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447447
Domainoid 1 1.000 54 1.000 Domainoid score I4143
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2695
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.