DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13481 and Rnf128

DIOPT Version :9

Sequence 1:NP_001097605.1 Gene:CG13481 / 39579 FlyBaseID:FBgn0036421 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001166820.1 Gene:Rnf128 / 315911 RGDID:1566282 Length:428 Species:Rattus norvegicus


Alignment Length:156 Identity:28/156 - (17%)
Similarity:55/156 - (35%) Gaps:55/156 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NSERTRILEQLQLNIFGQIS------------VEHHNAMNMSENLYELREGLDGL---------- 102
            |.:.|:||:.:|..|  |::            |.|::...:|.:.:.:.....|.          
  Rat   173 NLKGTKILQSIQRGI--QVTMVIEVGKKHGPWVNHYSIFFVSVSFFIITAATVGYFIFYSARRLR 235

  Fly   103 -----SRRMESMQEDI------------------------TCSICLSPWSSNGRHRVVSLRCGHL 138
                 ||:...::.|.                        :|::|:..:..|...|:  |.|.|:
  Rat   236 NARAQSRKQRQLKADAKKAIGRLQLRTLKQGDKEIGPDGDSCAVCIELYKPNDVVRI--LTCNHI 298

  Fly   139 FGNSCIRTAIRRSHRCPICRRRALHA 164
            |..:|:...:.....||:|:...|.|
  Rat   299 FHKTCVDPWLLEHRTCPMCKCDILKA 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13481NP_001097605.1 zf-RING_2 114..158 CDD:290367 11/43 (26%)
Rnf128NP_001166820.1 PA_GRAIL_like 48..193 CDD:239037 7/21 (33%)
zf-RING_2 275..318 CDD:290367 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.