DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13481 and SPCC548.05c

DIOPT Version :9

Sequence 1:NP_001097605.1 Gene:CG13481 / 39579 FlyBaseID:FBgn0036421 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_587745.1 Gene:SPCC548.05c / 2539314 PomBaseID:SPCC548.05c Length:468 Species:Schizosaccharomyces pombe


Alignment Length:138 Identity:30/138 - (21%)
Similarity:61/138 - (44%) Gaps:31/138 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QQLLDSDVSIEERV------RRMEVL----NNNMKWFNSERTRILEQLQLNIFGQISVEHHNAMN 87
            |.:||.|  .||..      .:||||    :|:..:.:|:.|::.::.:::             :
pombe     9 QVVLDED--DEENYNNNLDDEKMEVLLIPQSNSTTFASSDATQMYKKSRIS-------------S 58

  Fly    88 MSENLYELREGLDGLSRRMESMQEDITCSICLSPWSSNGRHRVVSLRCGHLFGNSCIRTAIRRSH 152
            .|||..::.: ...|....:.:::.:.|.||     :....|..:..|||.:...|:...::.|.
pombe    59 NSENKKQIPD-TKTLLETFQKIKKTLECPIC-----TEALQRPFTTHCGHTYCYECLLNWLKESK 117

  Fly   153 RCPICRRR 160
            .||.||::
pombe   118 SCPTCRQK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13481NP_001097605.1 zf-RING_2 114..158 CDD:290367 11/43 (26%)
SPCC548.05cNP_587745.1 RING 84..126 CDD:238093 13/47 (28%)
COG2888 <193..213 CDD:268082
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.