DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13481 and rfwd3

DIOPT Version :9

Sequence 1:NP_001097605.1 Gene:CG13481 / 39579 FlyBaseID:FBgn0036421 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_017948850.2 Gene:rfwd3 / 100492921 XenbaseID:XB-GENE-6041816 Length:752 Species:Xenopus tropicalis


Alignment Length:232 Identity:56/232 - (24%)
Similarity:87/232 - (37%) Gaps:91/232 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNSSESLNKMKSLVGKMIFMQVTEHLFLRAQQLLDSDVSIEERVRRMEVLNNNMKWFNSERTRIL 67
            :||..|||.         |.|:.     |.|.|..:    .|||.|..:|       .:|.||..
 Frog   125 TNSRASLNS---------FFQIN-----RTQGLAPT----SERVERNALL-------RTEATRTS 164

  Fly    68 -----------------------------------------EQLQLNIFGQISVEHHNAMNMSEN 91
                                                     |:||:|:     ||.........|
 Frog   165 PGGSSDETVELSEEEEGIESSTDVDEVEINAGAAPPAEPAPEELQINV-----VEVQAEAPAVSN 224

  Fly    92 LYELREGLDGLSRRMESMQ------------------EDITCSICLSPWSSNGRHRVVSLRCGHL 138
            |..:.|.:. |..:.::.|                  |..||:||..||::.|:||:.:||||||
 Frog   225 LVTVPESVT-LPLQTQTKQKTPVKQLSPVKTLPPEEDEGDTCAICFEPWTNAGQHRLSALRCGHL 288

  Fly   139 FGNSCIRTAIR-RSHRCPICRRRALHADVRRIFSRRI 174
            ||.:||...:: .:.:||.|.::|..||:..:::|.:
 Frog   289 FGFTCIERWLKGGAAKCPQCNKKAKRADIVVLYARSL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13481NP_001097605.1 zf-RING_2 114..158 CDD:290367 21/44 (48%)
rfwd3XP_017948850.2 mRING-C3HGC3_RFWD3 261..309 CDD:319364 22/47 (47%)
WD40 <473..572 CDD:421866
WD40 repeat 477..514 CDD:293791
WD40 repeat 520..558 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10072
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.