Sequence 1: | NP_001097605.1 | Gene: | CG13481 / 39579 | FlyBaseID: | FBgn0036421 | Length: | 176 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017948850.2 | Gene: | rfwd3 / 100492921 | XenbaseID: | XB-GENE-6041816 | Length: | 752 | Species: | Xenopus tropicalis |
Alignment Length: | 232 | Identity: | 56/232 - (24%) |
---|---|---|---|
Similarity: | 87/232 - (37%) | Gaps: | 91/232 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 SNSSESLNKMKSLVGKMIFMQVTEHLFLRAQQLLDSDVSIEERVRRMEVLNNNMKWFNSERTRIL 67
Fly 68 -----------------------------------------EQLQLNIFGQISVEHHNAMNMSEN 91
Fly 92 LYELREGLDGLSRRMESMQ------------------EDITCSICLSPWSSNGRHRVVSLRCGHL 138
Fly 139 FGNSCIRTAIR-RSHRCPICRRRALHADVRRIFSRRI 174 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13481 | NP_001097605.1 | zf-RING_2 | 114..158 | CDD:290367 | 21/44 (48%) |
rfwd3 | XP_017948850.2 | mRING-C3HGC3_RFWD3 | 261..309 | CDD:319364 | 22/47 (47%) |
WD40 | <473..572 | CDD:421866 | |||
WD40 repeat | 477..514 | CDD:293791 | |||
WD40 repeat | 520..558 | CDD:293791 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 63 | 1.000 | Domainoid score | I10072 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1451258at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |