DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and CPR2

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_011924.1 Gene:CPR2 / 856454 SGDID:S000001099 Length:205 Species:Saccharomyces cerevisiae


Alignment Length:162 Identity:93/162 - (57%)
Similarity:113/162 - (69%) Gaps:5/162 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKG-YGYKGSPFHRVIPNFMCQGGDFT 68
            :|:|||..|.||:||||:.|...|.||||:||..|.|.... .|:.||.|||||||||.||||||
Yeast    37 KVFFDIEHGEEKVGRIVIGLYGKVCPKTAKNFYKLSTTTNSKKGFIGSTFHRVIPNFMVQGGDFT 101

  Fly    69 NQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFI-CTGKTTWLDNKHVVFGKV 132
            :..|.||:||||:.||||||.|||...|.|||||.|.:|||||||| .|.:.:|||.||||||:|
Yeast   102 DGTGVGGKSIYGDTFPDENFTLKHDRKGRLSMANRGKDTNGSQFFITTTEEASWLDGKHVVFGQV 166

  Fly   133 VEGMDIVQKVESYGSQDG--KTSKKVIIEDCG 162
            |:|||:|..:: :.|:|.  |..:.|.|..||
Yeast   167 VDGMDVVNYIQ-HVSRDANDKPLEAVKIAKCG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 91/160 (57%)
CPR2NP_011924.1 cyclophilin 37..197 CDD:412213 91/160 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.