DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and CPR8

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_014425.3 Gene:CPR8 / 855762 SGDID:S000005311 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:164 Identity:44/164 - (26%)
Similarity:77/164 - (46%) Gaps:18/164 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYFDIAAGGEKLGRIV-MELRSDVVPKTAENFRALCTGEKG-----YGYKGSP---FHRVIPNFM 61
            :.|......|:.||:: ::|...:||||...|.......|.     :.|  ||   |.:::||..
Yeast    54 IVFTDPESSEEAGRLITIDLYGTMVPKTVMTFCQYVDSVKDRLASRHSY--SPERDFDKILPNGA 116

  Fly    62 CQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKH 126
            .:|.. .:.:......:...|.|:||..|.|...|.:||..   :..|.:|.|.|.:|. |:.:.
Yeast   117 IEGSS-VSSSSIEETEMLAPKLPEENHSLIHDRPGRVSMIK---DDKGLKFIIETSETP-LEGES 176

  Fly   127 VVFGKVVEGM-DIVQKVESYGS-QDGKTSKKVII 158
            ||||:|..|: |::.|:.:..: ::||..:.:.|
Yeast   177 VVFGQVTAGLKDLMDKLANVKTDENGKPEQPITI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 44/164 (27%)
CPR8NP_014425.3 cyclophilin 65..210 CDD:412213 41/151 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.